KEGG   Agrobacterium radiobacter: Arad_12253Help
Entry
Arad_12253        CDS       T00850                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00220  Arginine biosynthesis
ara00330  Arginine and proline metabolism
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01130  Biosynthesis of antibiotics
ara01230  Biosynthesis of amino acids
Module
ara_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Arad_12253
   00330 Arginine and proline metabolism
    Arad_12253
Enzymes [BR:ara01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Arad_12253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACM31272
UniProt: B9JQ53
Position
pAtK84c:190520..191410
Genome map
AA seq 296 aa AA seqDB search
MALGPKELLSHQTLLSALSEGGCDLAVELIEDVDDPAPDETAGYFDANVAGLFAGDQMSR
LQVQTARLARAVRYAVSADRMPLVANGGCTCALGMVAGLAAIGEIGMVWFDAHDDAETPE
TSTSGLVEGMPVSMITGRCWQAFCHQIPGFEPIPADRILTIGLHEKYEHKPDRGLKSPGS
VVTPAIVKSKGYDGAIIEALADLRTRCSKVYVHVDVDVLDPSVLKSSNHAAEGGLSAEQL
AYALDAIADSFEIVGLDFSSFDPTIDPHGVHTLVPLLVHAASASTRSRIHRNHCPG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcactaggcccgaaggagttactctcgcaccagacccttctgagcgctctatccgaa
ggcggttgcgatcttgccgtcgaattgattgaggatgtggatgatcccgcgccggatgaa
acggcgggctatttcgacgccaatgttgcggggctttttgccggcgaccagatgagccgt
cttcaagtgcagaccgcgcggcttgcgcgcgctgtccgctacgcagtgtctgccgaccgg
atgccactggtggcaaacggcggctgcacttgcgcacttggaatggttgcgggcctcgca
gcgatcggtgaaatcggaatggtgtggtttgacgcgcatgatgacgcggaaacgcccgaa
acctcgacaagcggccttgtcgaggggatgcccgtctcgatgatcaccgggcgatgttgg
caggctttctgccaccagatcccggggttcgagcctatcccggctgatcgtattctaacg
attggccttcatgagaagtacgaacataagccagaccgaggattgaagtcgcccggaagc
gtagtcacgccggccatcgtcaaaagcaagggttacgatggcgcgatcatcgaggcactg
gcggatctcaggacacgttgttctaaggtgtacgttcacgtagatgtcgacgttctggac
ccatccgttctgaaatcgagcaatcatgccgcagaaggtggcttgtctgccgaacaactt
gcatatgcgttggacgctatcgcagacagcttcgagatcgtcggcctggatttcagctcc
ttcgacccgacaatcgatccccatggcgtccacacacttgtcccgttgcttgttcatgca
gcgtcagcatcgacgcgaagccggatacaccggaaccattgccctggctga

DBGET integrated database retrieval system