KEGG   Agrobacterium radiobacter K84: Arad_12253Help
Entry
Arad_12253        CDS       T00850                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ara01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ara00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pAtK84c:190520..191410
Genome map
AA seq 296 aa AA seqDB search
MALGPKELLSHQTLLSALSEGGCDLAVELIEDVDDPAPDETAGYFDANVAGLFAGDQMSR
LQVQTARLARAVRYAVSADRMPLVANGGCTCALGMVAGLAAIGEIGMVWFDAHDDAETPE
TSTSGLVEGMPVSMITGRCWQAFCHQIPGFEPIPADRILTIGLHEKYEHKPDRGLKSPGS
VVTPAIVKSKGYDGAIIEALADLRTRCSKVYVHVDVDVLDPSVLKSSNHAAEGGLSAEQL
AYALDAIADSFEIVGLDFSSFDPTIDPHGVHTLVPLLVHAASASTRSRIHRNHCPG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcactaggcccgaaggagttactctcgcaccagacccttctgagcgctctatccgaa
ggcggttgcgatcttgccgtcgaattgattgaggatgtggatgatcccgcgccggatgaa
acggcgggctatttcgacgccaatgttgcggggctttttgccggcgaccagatgagccgt
cttcaagtgcagaccgcgcggcttgcgcgcgctgtccgctacgcagtgtctgccgaccgg
atgccactggtggcaaacggcggctgcacttgcgcacttggaatggttgcgggcctcgca
gcgatcggtgaaatcggaatggtgtggtttgacgcgcatgatgacgcggaaacgcccgaa
acctcgacaagcggccttgtcgaggggatgcccgtctcgatgatcaccgggcgatgttgg
caggctttctgccaccagatcccggggttcgagcctatcccggctgatcgtattctaacg
attggccttcatgagaagtacgaacataagccagaccgaggattgaagtcgcccggaagc
gtagtcacgccggccatcgtcaaaagcaagggttacgatggcgcgatcatcgaggcactg
gcggatctcaggacacgttgttctaaggtgtacgttcacgtagatgtcgacgttctggac
ccatccgttctgaaatcgagcaatcatgccgcagaaggtggcttgtctgccgaacaactt
gcatatgcgttggacgctatcgcagacagcttcgagatcgtcggcctggatttcagctcc
ttcgacccgacaatcgatccccatggcgtccacacacttgtcccgttgcttgttcatgca
gcgtcagcatcgacgcgaagccggatacaccggaaccattgccctggctga

DBGET integrated database retrieval system