KEGG   Agrobacterium radiobacter: Arad_1264Help
Entry
Arad_1264         CDS       T00850                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ara  Agrobacterium radiobacter
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arad_1264 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arad_1264 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Arad_1264 (thrC)
Enzymes [BR:ara01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Arad_1264 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1017929..1019326)
Genome map
AA seq 465 aa AA seqDB search
MDYISTRGEAPALGFCDALLAGLARDGGLYVPRQWPSLTKKEIRAFRGKSYQEVAFAVLS
PFTNGEIPDDVFRGMIDEAYATFRHPAVAPLVQTGPNSFVMELFHGTTLAFKDVAMQLLA
RLMDYALEKRGQRATIVGATSGDTGGAAIDAFAGRDRTDIFILFPNGKVSPVQQRQMTTS
TAANVHALAINGNFDDCQNLVKAMFNDKAFRDGVRLSGVNSINWARIMAQVVYYFTTAVA
LGGPDRKISFTVPTGNFGDIFAGYVAKRMGLPIDRLVIATNENDILARTLKTGRYEMRAV
KSTTAPSMDIQISSNFERLLFEAHGRDASKVRAAMESLKQSNGFAIGEDALKFIKKDFRA
GRASEKQVAATIRKTLDDTGYLIDPHTAIGVFVAEKNEKPTSPMVTLATAHPAKFPAAVK
SACGIDPALPTWLAGLMNREERFDVLDPELKAVETFIGNHTRAGE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtggactatatctcaacgcggggagaagcccctgcccttggcttctgcgacgctcttctg
gccggccttgctcgtgatggcgggctctatgttccccggcaatggccgagcctgacgaaa
aaagagattcgcgccttccgcggcaagagctaccaggaggtcgccttcgcggtgctgtcg
cccttcaccaatggcgaaatccccgatgacgtcttccgcggcatgatcgatgaggcctat
gccaccttccgtcacccggccgtcgccccgctggtgcagaccggtccgaacagcttcgtc
atggagctgttccacggcacgacgctcgccttcaaggatgtcgccatgcagctgctcgcg
cgactgatggactatgcgctggaaaagcgcgggcaacgggcgaccatcgtcggtgcgacc
tcgggcgacacgggcggcgctgcgatcgatgcctttgccggacgcgaccgcacggacatc
ttcattctcttccccaacggcaaggtctcgccggtgcagcagcggcagatgacgacctcg
acggccgccaacgtgcatgcgctggcgatcaacggcaatttcgacgattgccagaacctt
gtcaaagcgatgttcaacgacaaggctttccgcgacggcgtcaggctgtccggcgtcaat
tcgatcaactgggcacgcatcatggcgcaggtggtctattacttcaccaccgccgtcgcg
ctcggcgggccggaccggaagatttccttcactgtccccacaggtaatttcggcgatatc
ttcgccggctatgtcgccaagcgcatgggtctgccgatcgaccggctggtgatcgcgacc
aatgaaaacgatatcctcgcccgcacgctgaagaccgggcgctacgagatgcgcgcggtc
aagtcgaccacggcgccgtcgatggacatccaaatctcctccaatttcgaacggctattg
ttcgaagcccatggccgcgatgcatcgaaggtgcgcgccgcgatggaaagcctgaaacaa
tcgaacggtttcgcgatcggcgaagacgcactgaagttcatcaagaaggacttccgggcc
ggccgtgccagcgaaaagcaggtggccgcgacaatccgcaaaaccctcgacgacaccgga
tatctcatcgacccgcacaccgccattggcgtcttcgtggcggaaaagaatgagaaacca
acgagtcccatggtgacgcttgcaaccgcgcacccggcaaaattccccgccgcagtaaaa
tcggcatgtggtattgacccggcgcttccgacgtggcttgctggactgatgaacagggag
gagcgtttcgacgtcctcgatccggagcttaaagccgttgaaactttcatcggcaaccat
actcgggccggggaatga

DBGET integrated database retrieval system