KEGG   Agrobacterium radiobacter: Arad_1264Help
Entry
Arad_1264         CDS       T00850                                 

Gene name
thrC
Definition
(GenBank) threonine synthetase protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00260  Glycine, serine and threonine metabolism
ara00750  Vitamin B6 metabolism
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01120  Microbial metabolism in diverse environments
ara01230  Biosynthesis of amino acids
Module
ara_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arad_1264 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Arad_1264 (thrC)
Enzymes [BR:ara01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Arad_1264 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ACM25751
UniProt: B9JAR8
Position
1:complement(1017929..1019326)
Genome map
AA seq 465 aa AA seqDB search
MDYISTRGEAPALGFCDALLAGLARDGGLYVPRQWPSLTKKEIRAFRGKSYQEVAFAVLS
PFTNGEIPDDVFRGMIDEAYATFRHPAVAPLVQTGPNSFVMELFHGTTLAFKDVAMQLLA
RLMDYALEKRGQRATIVGATSGDTGGAAIDAFAGRDRTDIFILFPNGKVSPVQQRQMTTS
TAANVHALAINGNFDDCQNLVKAMFNDKAFRDGVRLSGVNSINWARIMAQVVYYFTTAVA
LGGPDRKISFTVPTGNFGDIFAGYVAKRMGLPIDRLVIATNENDILARTLKTGRYEMRAV
KSTTAPSMDIQISSNFERLLFEAHGRDASKVRAAMESLKQSNGFAIGEDALKFIKKDFRA
GRASEKQVAATIRKTLDDTGYLIDPHTAIGVFVAEKNEKPTSPMVTLATAHPAKFPAAVK
SACGIDPALPTWLAGLMNREERFDVLDPELKAVETFIGNHTRAGE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtggactatatctcaacgcggggagaagcccctgcccttggcttctgcgacgctcttctg
gccggccttgctcgtgatggcgggctctatgttccccggcaatggccgagcctgacgaaa
aaagagattcgcgccttccgcggcaagagctaccaggaggtcgccttcgcggtgctgtcg
cccttcaccaatggcgaaatccccgatgacgtcttccgcggcatgatcgatgaggcctat
gccaccttccgtcacccggccgtcgccccgctggtgcagaccggtccgaacagcttcgtc
atggagctgttccacggcacgacgctcgccttcaaggatgtcgccatgcagctgctcgcg
cgactgatggactatgcgctggaaaagcgcgggcaacgggcgaccatcgtcggtgcgacc
tcgggcgacacgggcggcgctgcgatcgatgcctttgccggacgcgaccgcacggacatc
ttcattctcttccccaacggcaaggtctcgccggtgcagcagcggcagatgacgacctcg
acggccgccaacgtgcatgcgctggcgatcaacggcaatttcgacgattgccagaacctt
gtcaaagcgatgttcaacgacaaggctttccgcgacggcgtcaggctgtccggcgtcaat
tcgatcaactgggcacgcatcatggcgcaggtggtctattacttcaccaccgccgtcgcg
ctcggcgggccggaccggaagatttccttcactgtccccacaggtaatttcggcgatatc
ttcgccggctatgtcgccaagcgcatgggtctgccgatcgaccggctggtgatcgcgacc
aatgaaaacgatatcctcgcccgcacgctgaagaccgggcgctacgagatgcgcgcggtc
aagtcgaccacggcgccgtcgatggacatccaaatctcctccaatttcgaacggctattg
ttcgaagcccatggccgcgatgcatcgaaggtgcgcgccgcgatggaaagcctgaaacaa
tcgaacggtttcgcgatcggcgaagacgcactgaagttcatcaagaaggacttccgggcc
ggccgtgccagcgaaaagcaggtggccgcgacaatccgcaaaaccctcgacgacaccgga
tatctcatcgacccgcacaccgccattggcgtcttcgtggcggaaaagaatgagaaacca
acgagtcccatggtgacgcttgcaaccgcgcacccggcaaaattccccgccgcagtaaaa
tcggcatgtggtattgacccggcgcttccgacgtggcttgctggactgatgaacagggag
gagcgtttcgacgtcctcgatccggagcttaaagccgttgaaactttcatcggcaaccat
actcgggccggggaatga

DBGET integrated database retrieval system