KEGG   Agrobacterium radiobacter K84: Arad_1279Help
Entry
Arad_1279         CDS       T00850                                 

Definition
hydrolase
Orthology
K01560  
2-haloacid dehalogenase [EC:3.8.1.2]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Chlorocyclohexane and chlorobenzene degradation
Chloroalkane and chloroalkene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ara00625]
Metabolism; Xenobiotics biodegradation and metabolism; Chlorocyclohexane and chlorobenzene degradation [PATH:ara00361]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1027592..1028206)
Genome map
AA seq 204 aa AA seqDB search
MTTEIRHIVFDIGKVLIHYDPNIPYSRIIPDKTERDWFLTNVCTHEWNIEQDRGRTWEDA
EALLIAEHPEREEQIRAFRKHWHEMVPHAYDDSIAIFEGLIAEGRDVTMLTNFASDTFRE
AQARFDFLNKPRGVTVSGDIGLIKPDVAIYERHVKSFGLDPASTIFIDDSLANVEGAKAA
GWHAVHFTGAAKLRSDLAAYGIKV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggaaatccggcacattgtcttcgatatcggcaaggttctcattcactacgat
ccgaatattccctacagccgtatcattcccgacaagacggagcgtgactggttcctcacc
aatgtctgcacccacgaatggaacatcgagcaggatcgcggccgcacctgggaagacgcc
gaggcgctgctgattgccgaacatccggagcgcgaagagcagatccgcgccttccgcaag
cattggcacgagatggtgccgcatgcctatgatgacagcattgcgatcttcgaaggattg
atcgcggaaggccgcgatgtcaccatgctgaccaatttcgcatccgacacgtttcgggag
gcgcaggcgcgcttcgatttcctcaacaagccgcgcggcgttaccgtgtccggcgatatc
ggtctgatcaagccggatgtcgcgatctatgagaggcatgtgaagagtttcggcctcgat
cccgcgtcgacgatcttcattgacgattcgctcgccaacgtcgaaggcgccaaggcggcc
ggctggcatgcagttcatttcaccggcgctgcgaagctgcgcagcgatctcgccgcctac
ggcattaaggtttga

DBGET integrated database retrieval system