KEGG   Agrobacterium radiobacter: Arad_1279Help
Entry
Arad_1279         CDS       T00850                                 

Definition
hydrolase
Orthology
K01560  
2-haloacid dehalogenase [EC:3.8.1.2]
Organism
ara  Agrobacterium radiobacter
Pathway
Chlorocyclohexane and chlorobenzene degradation
Chloroalkane and chloroalkene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Arad_1279
   00361 Chlorocyclohexane and chlorobenzene degradation
    Arad_1279
Enzymes [BR:ara01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Arad_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1027592..1028206)
Genome map
AA seq 204 aa AA seqDB search
MTTEIRHIVFDIGKVLIHYDPNIPYSRIIPDKTERDWFLTNVCTHEWNIEQDRGRTWEDA
EALLIAEHPEREEQIRAFRKHWHEMVPHAYDDSIAIFEGLIAEGRDVTMLTNFASDTFRE
AQARFDFLNKPRGVTVSGDIGLIKPDVAIYERHVKSFGLDPASTIFIDDSLANVEGAKAA
GWHAVHFTGAAKLRSDLAAYGIKV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggaaatccggcacattgtcttcgatatcggcaaggttctcattcactacgat
ccgaatattccctacagccgtatcattcccgacaagacggagcgtgactggttcctcacc
aatgtctgcacccacgaatggaacatcgagcaggatcgcggccgcacctgggaagacgcc
gaggcgctgctgattgccgaacatccggagcgcgaagagcagatccgcgccttccgcaag
cattggcacgagatggtgccgcatgcctatgatgacagcattgcgatcttcgaaggattg
atcgcggaaggccgcgatgtcaccatgctgaccaatttcgcatccgacacgtttcgggag
gcgcaggcgcgcttcgatttcctcaacaagccgcgcggcgttaccgtgtccggcgatatc
ggtctgatcaagccggatgtcgcgatctatgagaggcatgtgaagagtttcggcctcgat
cccgcgtcgacgatcttcattgacgattcgctcgccaacgtcgaaggcgccaaggcggcc
ggctggcatgcagttcatttcaccggcgctgcgaagctgcgcagcgatctcgccgcctac
ggcattaaggtttga

DBGET integrated database retrieval system