KEGG   Agrobacterium radiobacter: Arad_14112Help
Entry
Arad_14112        CDS       T00850                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ara  Agrobacterium radiobacter
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Arad_14112
Enzymes [BR:ara01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Arad_14112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pAtK84b:complement(72925..74391)
Genome map
AA seq 488 aa AA seqDB search
MKNSVQLITYVDRLSGGGFPELRALLDGRLQGLFGGVHALPFFNPIDGADAGFDPTDHTI
VDPRLGSWDDVRTLAGSVEIMADLIVNHVSAQSSWFQDFIAKGPDSEFADMFMTFGKVFP
RGASEQDLLNIYRPRPGLPFSKATLGDGSQRMLWTTFTPQQIDIDVHSAHGALYLETILD
RFAEANVTAIRLDAAGYAIKKAGTSCFMIDETYAFLAKLAEKARDRGMEVLVEIHSYYRD
QIEIARKVDRVYDFALPPLILHSLFTGDATALARWLEISPRNAITVLDTHDGIGVIDVGA
HGHGRAGLLEPQAIDHLVEEIHRRSEGQSRLATGAAASNLDLYQVNCTYYDALGRSDNDY
LIARAIQFFAPGIPQVYYVGLLGGLNDMELLRKTGVGRDINRRFFEDREIDLALESPLVK
RLSDLIRFRNTHPAFNGSFEVATDDTGSLVLSWNFDAEFARLVVSFSQGKATITASGCYD
FTFSGDVA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacagtgtacaacttatcacctacgtcgaccggttaagcggaggtggtttcccg
gagttgagagctttgctcgacgggaggctacaaggcctgttcggcggcgtccatgccttg
cctttcttcaacccgatagacggcgctgatgccgggttcgatcccaccgatcacacgatt
gtcgatcctcgcctcggtagctgggatgatgttcgcaccctggccggctccgtggagatc
atggccgatctcattgtcaaccatgtctcggcgcaatcgagctggttccaggacttcatc
gcaaaaggtcctgattcagaattcgcagacatgttcatgacattcggcaaggtctttccc
cgcggtgccagcgagcaggatctcctgaatatctataggccacgccctgggctgccgttt
tcaaaggccacgcttggagatggcagccagcggatgctgtggaccacatttaccccccaa
cagatcgacatcgatgtccacagtgcccatggcgccttatacctggagactatccttgat
cgctttgctgaagccaacgtaacggcaatccgcctcgatgccgccggctacgcgatcaag
aaggccggaaccagttgcttcatgattgatgagacctatgccttccttgccaagctggcc
gagaaggcacgggatcgcgggatggaggttcttgtcgaaattcacagttactatcgtgac
cagatcgaaatcgccaggaaggttgaccgcgtatacgatttcgcgctgccgccactgata
ttgcattcattgttcacgggcgatgcgacagcgctggcgcgttggttggagatcagccct
cgcaacgcaatcaccgtcctcgacactcacgacgggatcggcgtcatcgatgtcggcgcg
cacggccatggccgagccggccttctggaaccgcaggcgatcgaccatctggtcgaggag
atccacaggcgttcggaggggcagagccgtttggcaacaggcgctgcagcttctaacctg
gatctctatcaggtgaactgcacctattacgacgcgctcggccgcagcgacaacgactac
ctcatcgcccgcgcaatccagtttttcgcgcctggtattccgcaagtctattacgtcggt
ctcttgggggggcttaacgacatggaattgctgagaaagaccggggtcgggcgtgacatc
aatcggcgcttttttgaagaccgggaaattgatctcgctcttgaatcgccgctcgtcaaa
cgactgtcggacttgatccgcttccgtaacacccatccggccttcaatggatcgttcgag
gtagcaaccgatgacaccggaagccttgttctaagctggaatttcgacgccgagtttgct
cggctagtagtttcgttctcccaaggcaaggcaacgatcacggcttcaggctgctacgat
ttcacattctcaggagacgtcgcatga

DBGET integrated database retrieval system