KEGG   Agrobacterium radiobacter K84: Arad_14153Help
Entry
Arad_14153        CDS       T00850                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ara01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ara00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pAtK84b:complement(105036..106043)
Genome map
AA seq 335 aa AA seqDB search
MIVRPSPQRGDQRCSQEMNASRRRKENELKTCQILGAPVQSGASQPGCLMGPDAFRTAGL
SRALTELGWAVTDLGDATPTAEPEISHTNSAVKNLDAMVGWTRSLSKKALEMARSCDLPV
FLGGDHSMSAGTVSGVAERAAELDKEQFVLWLDAHADLHTLHTTASGNLHGTPVAYYTGQ
PGFEGLPPLAAPVDPRNVSMMGIRSVDPEERRRVAEIGIEVADMRVLDEQGVVRPLGVFL
DRVSKAKGRLHVSLDVDFLDPGIAPAVGTTVPGGATFREAHLIMEMLHDSGLVTSLDLAE
LNPFLDERGRTARLMTDLAASLFGRRVFDRVTTAF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgttcggccatcgccacagcgtggtgaccaaaggtgcagtcaagaaatgaacgcc
tcgcggcgtcgcaaggagaatgagttgaagacgtgccaaatcctgggagcccccgttcaa
agcggcgcatcccaacccggatgcctgatggggcctgatgcttttcggactgccggcttg
tcgcgagctttgacggaactgggctgggccgtcactgatctcggagatgcgacgccgacg
gcggagcccgaaatcagtcacaccaattccgctgttaagaacctcgacgctatggtggga
tggacgcgcagtctctccaaaaaagcgctggagatggcccgcagctgcgatcttccggtt
tttctcggcggcgatcactcaatgtctgccggcaccgtttccggggtggccgaacgagcg
gccgaactcgacaaggagcaattcgtcctctggctggacgcgcacgcagacctgcatacc
ctacacacgactgcaagcggcaatcttcatggcacgccggtcgcctactatacgggccag
cctggcttcgaagggctaccgccgctggcagcgcctgtggatccccgcaacgtatccatg
atggggattcgctcggtcgacccggaagaaaggcgccgggttgccgagatcggtatcgaa
gtcgccgacatgcgggttctggacgagcaaggcgtcgtacgcccgctgggcgtctttctt
gaccgcgtgagcaaggccaagggcagattgcacgtcagcctcgacgtcgacttcctcgat
cccgggattgcgccggcggtgggcaccacggttccgggcggggcgactttccgagaggca
cacctcatcatggagatgctccatgacagcggtctcgtcacctcgctcgaccttgcggag
ctcaatccgtttctggacgagcgaggacgtacggcccgactgatgaccgatcttgccgcg
agcctgttcggccggcgcgtgttcgacagggtgacaacagcattttga

DBGET integrated database retrieval system