KEGG   Agrobacterium radiobacter: Arad_1623Help
Entry
Arad_1623         CDS       T00850                                 

Definition
(GenBank) phosphatase protein
  KO
K09474  acid phosphatase (class A) [EC:3.1.3.2]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00740  Riboflavin metabolism
ara01100  Metabolic pathways
ara02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Arad_1623
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Arad_1623
Enzymes [BR:ara01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     Arad_1623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAP2 PAP2_3 Pilosulin PAP2_C
Motif
Other DBs
NCBI-ProteinID: ACM26016
UniProt: B9JC95
Position
1:complement(1290319..1291017)
Genome map
AA seq 232 aa AA seqDB search
MRNLARTFTLLLAVGLAAPVFADEAKPFADAKEINLLNLLPPPPANDSAQTKAELGEILT
LQVTRTPEMAARAVADAEENVWRFSDVIDNPKFTKENLPKFSAFFDRIVETEGAVVDPAK
DVWKRPRPHLYSDLVKPIVPLSKSGSYPSGHTTLGTLMGIVLSNMVPEKKAAIMTRAWEY
GHNRIVGGIHYATDIEAGRIAGTVIAQTITTHEDYKAEYEAARDELRAALGL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatctcgccagaacctttaccctccttctcgccgtcggtcttgccgcgccggtc
ttcgccgacgaagccaagccatttgccgatgccaaggagatcaatctcctgaaccttctg
cccccaccaccggccaatgactcggcccagaccaaagccgagctgggagaaatcctgacg
ctgcaggtgacacgcaccccggaaatggcggcccgtgccgttgccgacgccgaggaaaac
gtctggcgcttctccgacgtcatcgacaatccgaaattcaccaaggaaaaccttccgaag
ttctcggccttcttcgatcgtatcgtcgaaaccgagggcgccgtcgtcgatccggccaag
gatgtctggaagcgcccgcgcccgcatctttacagcgatctcgtcaagccgatcgtgcct
ctgtcgaagtccggttcctatccgtccggccacacgacgctcggaacactgatgggtatc
gtgctttcgaacatggtgccggaaaagaaggctgccatcatgacccgcgcctgggaatac
ggccataaccgtatcgtcggcggcatccactacgccaccgacattgaggccggccgcatc
gcgggcaccgtcatcgcgcagaccatcacgacccatgaggactataaggccgaatacgag
gccgccagggacgagctgcgagccgccctcggcctctga

DBGET integrated database retrieval system