KEGG   Agrobacterium radiobacter: Arad_1652Help
Entry
Arad_1652         CDS       T00850                                 

Definition
(GenBank) multidrug resistance efflux system protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 OEP Biotin_lipoyl E2R135 HrpB7 DUF4407 DUF1741
Motif
Other DBs
NCBI-ProteinID: ACM26036
UniProt: B9JCB5
Position
1:1313329..1314393
Genome map
AA seq 354 aa AA seqDB search
MSRLVRSPIEVIAVLAGVGGVMLVLYAWHLPPFKSSVETTDDAYVKGYVTTISPQVSGYI
TDVPIKDYKLVKQGEVLTKIDDRIYQQKVAQARATLAGQKAALANSQQQEQAAKAGIASS
QAQIDSANAALKRAQLAADRVTTLVAKGVSTTSDSEQAQATLQQAQASVNQAKAALDVSQ
QNLTTIIVNRASLEAGVSGAEAAVQLAEIDLQNATIVAPQDGRVGEVGVRLGQYVTAGTQ
LMGLVPKDIWVIANFKETQLDGMKIDQPATISVDALGHRQLKGHVQRFSPAAGSEFAVIK
PDNATGNFTKVAQRIGVRIKIDKDQPLADDLAPGMSVVVSIDKDSQPEVGVNDD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggctcgttcgctcccccatcgaagtcattgccgttcttgccggtgtcggcggc
gtcatgctggtgctttatgcctggcatctgccgcccttcaaaagctctgtcgagacgacc
gacgatgcctatgtcaaaggctatgtcaccaccatcagcccgcaggtcagcggctatatc
accgatgtcccgatcaaggactacaagctcgtcaagcagggcgaggtgctgaccaagatc
gacgaccgcatctatcagcagaaggtggcgcaggcgcgcgcgacgctggccggccagaag
gcggcgcttgccaattcgcagcagcaggagcaagccgccaaggccggcatcgcctccagc
caggcgcagatcgacagcgccaatgccgcgctgaagcgtgcacagcttgctgcagatcgc
gtcacgacgctggtggccaagggcgtgtccacgacaagtgattccgagcaggcacaggcg
acgctgcaacaggcgcaggcatcggtcaaccaggcgaaggcggcccttgacgtatcgcag
cagaacctcacgacgatcatcgtcaaccgcgcctcgctggaggccggcgtcagcggcgcg
gaagcggccgtgcagcttgccgagatcgatcttcagaacgcgaccatcgtcgcaccgcag
gacgggcgtgtcggagaagtcggcgtgcgcctcggccaatatgtgaccgctggaacgcag
ctcatgggtctcgtgcccaaggatatctgggtgatcgccaatttcaaggaaacccagctc
gacggtatgaagatcgatcagcccgcgacgatctcggtcgacgcgctcggccaccgccag
ctcaagggtcacgtccagcgcttctcgccggcggcgggctcggaattcgccgtcatcaag
cctgacaacgcgaccggcaatttcaccaaggtcgcgcagcgcatcggcgtcaggatcaag
atcgacaaggatcaaccgctggcggatgatctggcaccgggcatgtcggtcgttgtctcg
atcgacaaggactcccagccggaggttggtgtcaacgacgactga

DBGET integrated database retrieval system