KEGG   Agrobacterium radiobacter: Arad_1657Help
Entry
Arad_1657         CDS       T00850                                 

Gene name
rpsR
Definition
(GenBank) ribosomal protein S18
  KO
K02963  
small subunit ribosomal protein S18
Organism
ara  Agrobacterium radiobacter
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ara00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Arad_1657 (rpsR)
Ribosome [BR:ara03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Arad_1657 (rpsR)
  Bacteria
    Arad_1657 (rpsR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(1316245..1316493)
Genome map
AA seq 82 aa AA seqDB search
MSEVSSAPVRRPFHRRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITAVSQKK
QRELAQAIKRARFLGLLPYVVA
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagtttcctccgcaccggttcgccgtccgttccatcgccgccgcaagacctgc
ccgttctcgggcgccaatgcgccgcgcatcgactacaaggacgtccgtctcctgcagcgc
tacatttccgagcgtggcaagatcgttccgtcccgcatcacggccgtttcccagaagaag
cagcgcgaactcgcccaggcgatcaagcgcgcccgtttcctcggcctgctgccttacgtc
gtcgcttaa

DBGET integrated database retrieval system