KEGG   Agrobacterium radiobacter: Arad_1663Help
Entry
Arad_1663         CDS       T00850                                 

Definition
(GenBank) Methyltransferase protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_21 PepSY_2
Motif
Other DBs
NCBI-ProteinID: ACM26043
UniProt: B9JCC2
Position
1:complement(1319331..1320194)
Genome map
AA seq 287 aa AA seqDB search
MTYNLIWIVRMFDVRKLTFSSMAAIFDRFHSNKSMQRMIFNAIRLNRPQISDIILNEDVR
FISYCLSRRERSKAQIMQDLWVCFELSEKRNGFFVEFGSTNGLKNSNTWLLEKKFDWNGI
LAEPNPIWHADLAANRTAAIEHKCVSSKSNEIVTFIATDESDPELSAIADFAKGDHFSDV
RSQGKHIQVETISLDDLLEKYQAPPTVDYLSIDTEGSELDILSAYSFDRKFDLISVENNP
KTEKAIQGLLESKGYKRVFEQFSQWDGWYVSGRLRDGKKIEIAAPSS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
ctgacttataatctcatctggatagtcagaatgttcgatgtaagaaaacttactttttcc
agcatggcagctattttcgatagatttcacagcaataaatctatgcagagaatgatattc
aatgccattcgtctgaaccggccccagatatcagacatcatcttgaatgaagacgtcaga
tttattagttattgcttatcaaggagggagcggtccaaagcccagatcatgcaggattta
tgggtctgttttgagctgtcggaaaagagaaacgggtttttcgtggaattcggttcaacc
aatggactgaaaaacagcaatacttggctgctcgaaaagaaattcgactggaacggtatc
ctggccgaacccaatccaatctggcacgcggatctcgcggccaacagaacagccgctatc
gagcacaaatgcgtctcttcgaaatccaacgagattgtcacgtttatcgcgaccgatgaa
tccgatcccgaactgagcgcgatcgccgatttcgccaagggcgaccacttctccgacgtt
cgcagccagggaaagcacatccaggtggaaaccatatccctggacgatctgctggaaaaa
tatcaggcaccgcccaccgtagactatctgtcgatcgacacggaaggcagcgagctggac
atattgtccgcctacagcttcgaccggaaattcgatctcatatcggtagagaacaatcca
aagacggaaaaagcgatacaagggctgctggagagcaagggatacaagagagtattcgag
caattctcccaatgggacggctggtatgtctccggcaggcttcgggacggaaaaaagatc
gagatagcggcaccgtcatcttga

DBGET integrated database retrieval system