KEGG   Agrobacterium radiobacter: Arad_1675Help
Entry
Arad_1675         CDS       T00850                                 

Gene name
gmk2
Definition
(GenBank) guanylate kinase (GMP kinase) protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00230  Purine metabolism
ara01100  Metabolic pathways
Module
ara_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Arad_1675 (gmk2)
Enzymes [BR:ara01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Arad_1675 (gmk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_22 AAA_29 ABC_tran Cytidylate_kin AAA_18 Thymidylate_kin
Motif
Other DBs
NCBI-ProteinID: ACM26051
UniProt: B9JCD0
Position
1:1327644..1328306
Genome map
AA seq 220 aa AA seqDB search
MKPVISTSIPIARRGLMLAISSPSGAGKSTIARTLLDTDKHVGLSVSVTTRQRRPSEIAG
VHYHFVSQREFERLRDSDSLLEWAEVHGNFYGTPREPVETAMAEGRDMLFDIDWQGAQQL
QEKMPADVVSIFVLPPTMTELQSRLHRRAEDSEEVIATRLANSRSEIAHWREYDYVIIND
DLNAAFDAVQSIVKAERLRRDRRHGMFDFVRGLLEETPKL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggtgatatccacatccattccaattgcccgtcgggggctgatgttggctatt
tcctcgccgtcgggcgcgggaaagtcgaccatcgcccgcactctgctcgacaccgacaag
catgtcggcctttccgtcagcgtcacgacacggcagcgtcggccgagcgagatcgccggc
gtgcattatcatttcgtctcgcagcgggagttcgagcggcttcgtgattccgattcgctg
ctcgaatgggccgaggtgcatggcaatttctacggcacgccgcgcgagccagtggaaacg
gcgatggccgagggccgcgacatgctcttcgatatcgactggcagggcgcgcagcagctt
caggagaagatgcccgccgatgtcgtctccatcttcgtgctgccgccgaccatgacggag
ctgcaatcgcgcctgcaccgtcgcgccgaggattccgaagaggtgattgccacgcggctt
gccaattcgcgatcggagatcgcccattggcgtgagtatgactacgttatcatcaacgac
gacctgaatgccgccttcgatgcggttcagtcaatcgtcaaggccgaacgcctgcgccgc
gaccgccgtcacggcatgttcgatttcgtacgtggtctcctggaagaaacgccgaagctc
tga

DBGET integrated database retrieval system