KEGG   Agrobacterium radiobacter: Arad_1698Help
Entry
Arad_1698         CDS       T00850                                 

Definition
(GenBank) ABC transporter
  KO
K06158  
ATP-binding cassette, subfamily F, member 3
Organism
ara  Agrobacterium radiobacter
Brite
Translation factors [BR:ara03012]
 Eukaryotic Type
  Initiation factors
   Initiation associated factors
    Arad_1698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(1347726..1349615)
Genome map
AA seq 629 aa AA seqDB search
MISISDLSARIAGRLLIDHANVTLPAGTKAGLVGKNGAGKSTLFRVITGDFAAESGSVAI
PRNARIGQVAQEAPGTEEPLIEIVLKADKERTALLAEAETATDPHRIADIQTRLADIGAH
SAEARAASILAGLGFDHEAQHRPASSFSGGWRMRVALAAVLFSEPDLLLLDEPTNYLDLE
GTLWLEDYIRRYPHTVIIISHDRDLLNTAVNAIVHLDQKKLTFYRGSYDQFERQKAEADE
LQNKAKAKNDAARKHLQSFIDRFKAKATKARQAQSRVKALERMGTVAAVIEDHVMGFSFP
EPEKQAASPIIAVTGGAVGYEPGKPILKRLNLRIDADDRIALLGSNGNGKSTFAKFVSGR
LDADSGDVKLAPNLKIGFFAQHQLDDLVPNQTAVEHVRRRMPDAPEPKVRARVAQMGLAT
EKMDTPVKDLSGGEKARLLMGLAAFDAPNLLILDEPTNHLDIDSRNALIQALNDYSGAVI
LISHDRHLIEATVDQLWLVRDGTVSTFDGDLEEYRSLVVASPKARDDKAKANGTDDAVSK
ADQRKLNADRRASLAPLRKKINEIESLTAKLEKLIQALDVELADPALYEKAPAKAAEKAK
QRSDAAEKLAAAEEQWLELSSEYESAMAG
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgatttccgacctttccgcccgcattgccggccgtcttctcatcgaccatgcc
aacgtgacgcttccggcgggcacaaaagctgggcttgtcggcaagaatggcgccggcaaa
tcgacactgttccgggtgatcaccggcgatttcgccgctgagagcggatcggtcgcgatc
ccgcgtaacgcccgcatcggccaggtggcacaggaagcgccgggtacggaagagccactg
atcgagatcgtgctgaaagccgacaaggagcgcactgccctgctggcagaggccgagacg
gcgaccgatccgcaccgcatcgctgacatccagacccggcttgccgatatcggtgctcat
tcggccgaagcgcgcgccgccagcattctggccggtctcggcttcgaccatgaggcgcag
caccgccccgcctcttccttttccggcggctggcgcatgcgcgtggcgcttgcggccgtg
ctgttctccgagccggatctgctgctgctcgacgaaccgaccaactatctcgatcttgaa
ggcacgctctggctcgaagactatatccgccgctacccgcacacggtcatcatcatctcg
catgaccgcgatctgctgaacacggccgtcaacgccatcgtccatctcgaccagaagaag
ctcaccttctatcgcggctcctacgaccagttcgagcggcagaaggcggaggccgacgag
ctgcagaacaaggccaaggccaaaaacgatgcggcgcgcaagcacctgcagagcttcatc
gaccgcttcaaggccaaggcaacgaaggcgcggcaggcgcagtcgcgcgtcaaggcgctg
gagcgcatgggcacggtcgccgccgtcatcgaagatcatgtgatgggcttcagctttccc
gagccggaaaagcaggcggcatcgccgatcatcgccgtcaccggaggtgctgtcggctac
gagcccggcaagccgatcctcaagcgcctcaacctgcgcatcgacgccgacgatcgcatc
gcactcctcggctcgaacggcaacggcaaatccaccttcgccaaattcgtctccggccgt
ctcgatgccgatagcggcgacgtgaagctcgcgccgaacctgaagatcggcttcttcgcg
cagcatcagctcgacgacctcgtgccgaaccagaccgccgtcgaacatgtgcgccgccgc
atgcccgacgcgccggaaccgaaggtgcgcgcccgcgtcgcgcagatggggcttgcgacc
gagaagatggacacgccggtgaaggatctttccggtggtgagaaggctcggctgctgatg
ggccttgccgccttcgacgcgccgaacctgctgatcctcgacgaaccgaccaaccatctc
gacatcgacagccgcaatgcgctgatccaggcgctgaacgactattccggcgccgtcatc
ctgatctcgcacgaccgccatctgatcgaggcgactgtcgatcagctttggctggtgcgc
gacggcacggtttccaccttcgacggcgaccttgaagaataccgcagcctcgtggtcgcc
agccccaaggccagggacgacaaggccaaggcgaatggcaccgacgatgccgtctcgaag
gcggatcagcgcaagctcaatgccgaccgccgtgcttcgctcgcgccgctccggaaaaag
atcaacgaaatcgaatccttgacggctaagctggagaaactgattcaggcgcttgatgtg
gaacttgcggatcccgcgctctacgagaaggcacccgcaaaggctgccgagaaggccaag
cagcgctccgacgcagcggagaagcttgccgccgccgaggagcagtggctcgagctttcc
tcggaatatgaaagcgcgatggccggttag

DBGET integrated database retrieval system