KEGG   Agrobacterium radiobacter: Arad_1705Help
Entry
Arad_1705         CDS       T00850                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACM26072
UniProt: B9JCT5
Position
1:complement(1351570..1352055)
Genome map
AA seq 161 aa AA seqDB search
MAAIAGLTIAGCQREPESGPTELSGRLFVFNYRVATASYMITLKKIAPIPEGTTAVAEFE
NPAGGDPLVVRQKIFAFWDKITLESPDLRCVRKDRPYSVSIRLVDASDKTIQTIKTEVKS
DLDQTVLPTKPLVVGPVYTENPDVFKSDGSVDYGHDTACPA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaatcgccgggctcaccattgccggctgtcagcgagagccggaaagcggcccg
accgaactcagcggccggctcttcgtcttcaactatcgcgtcgcgaccgcgagctacatg
atcaccctgaagaagatcgcgccgatcccggaagggacgacggcggttgcggaattcgaa
aatccggcgggtggcgatcccctggtggtgcggcagaagatctttgcgttctgggacaag
atcacgctcgagagcccggatctgcgctgtgtgcgcaaggatcgcccctattctgtctcg
atcaggctggtcgatgccagcgacaagacgatccagaccatcaagaccgaggtgaaatcc
gacctcgaccagaccgtgctgccgacgaagccgcttgtcgtcggcccggtctacacggaa
aatccggatgtcttcaaaagcgacggcagcgtcgactatgggcacgataccgcctgcccg
gcatga

DBGET integrated database retrieval system