KEGG   Agrobacterium radiobacter: Arad_1711Help
Entry
Arad_1711         CDS       T00850                                 

Gene name
pgsA
Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K08744  cardiolipin synthase (CMP-forming) [EC:2.7.8.41]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00564  Glycerophospholipid metabolism
ara01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Arad_1711 (pgsA)
Enzymes [BR:ara01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.41  cardiolipin synthase (CMP-forming)
     Arad_1711 (pgsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf Phage_holin_4_1 Tail_VII
Motif
Other DBs
NCBI-ProteinID: ACM26077
UniProt: B9JCU0
Position
1:complement(1354439..1355026)
Genome map
AA seq 195 aa AA seqDB search
MASRAYSIPNLLTYGRILCVPLIVLCFFVEGRLEGSDFARWVALWIFIIASLTDFLDGYL
ARIWNQTSNIGRMLDPIADKLLVASILLLVAADGTIAGWSLWAAIIILCREILVSGLREY
LAALKVSVPVTRIAKWKTTAQLVAIAFLLAGPAGDKVLPYTTELGIVLLWIAALLTIYTG
YDYFRAGLKHIVDEE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgcgcgcatacagcattcccaatctgcttacctatggccgcatcctttgcgta
ccgctgatcgtcctatgcttcttcgtcgaaggcaggttggagggatccgattttgcgcga
tgggtagcgctctggatcttcatcatcgcctcgctcaccgatttcctcgacggctatctg
gcccgcatctggaatcagacctcgaatatcggccgcatgctcgacccgatcgccgacaag
ctgctggtcgcctcgatcctgctgctggtggctgccgacggcaccatcgccggctggtcg
ctctgggcggcaatcatcattctgtgccgtgagatactcgtctccggcctgcgcgaatat
ctggcggcgctgaaggtcagcgtgccggtgacgcgcatcgccaaatggaagaccaccgcg
cagctcgtcgccatcgccttcctgctggctgggccggcgggcgacaaggtgctaccctat
acgacggaactcggcatcgtcctgctctggatcgcggcgctgctgacgatctataccggc
tacgactatttccgcgcaggattgaagcatatcgtggacgaagaatga

DBGET integrated database retrieval system