KEGG   Agrobacterium radiobacter: Arad_1721Help
Entry
Arad_1721         CDS       T00850                                 

Definition
(GenBank) anaerobic dehydrogenase protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4
Motif
Other DBs
NCBI-ProteinID: ACM26083
UniProt: B9JCU6
Position
1:1360713..1362836
Genome map
AA seq 707 aa AA seqDB search
MNIATPIPTKSKIGHTACPHDCPSTCALEIDLTEDGKVGRVRGARDHSYTSGVICAKVAR
YAERLYHPDRLMKPLRRAGAKGEGRWQELSWDDALDEIANAFVKAEARDGSEAVWPYYYA
GTMGLVQRDSINRLRHAKRYSGFFSSICTNPAWTGFTMATGTLRGPDPHEMGRTDCVVIW
GTNAVATQVNVMTHAVKSRKERGAKIVVIDIYDNPTMKQADLALIVKPGTDAALACAVMH
VAFRDGYADRAYMAKFADDPAGLEAHLQTKTPEWAAAITGLSVDEIEAFARLVGTTKKSY
FRLGYGFTRQRNGAVAMHAAASIATVLGSWQYEGGGAFHSNSDIFRIDGSELTGRSMLDQ
DVRMIDQSQIGRALTSDAVALRHRGPVTAMLIQNTNPVNIAPEQRLVKRGFARNDLFVAV
HEQFMTDTAEMADIVIPATMFVEHDDIYRAGGQNHILLGPKLVEPPSTVRSNLFVIEELA
KRLGVADRPGFGFSAREMVDRILSDSGLPDYDYFLEHKWFDRQPAFEEAHFLNGFAHSDG
RFRFRPDWVNQPAPNRPPEAVGLLGPHIELPEFPDQVDVIEVADPDHPFRLATSPARNFL
NSSFAETKTSRQKEGRPEVMINPADAAALEVIEGDLVQIGNVRGDIRLHARITTEVKPGV
LIAEGLWPNKAHVDGEGINVLTGADPVAPYGGAAVHDNKVWLRKDAK
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgcgacccccattcccaccaaatccaagataggccacacggcctgtccgcac
gactgtccctccacctgcgcgctggagatcgatctgaccgaggatggcaaggtcggtcgg
gtgcgcggcgcaagggaccattcctatacgtcgggcgtcatttgcgccaaggtcgcccgc
tatgccgagcggctttatcatcccgaccggctgatgaagccgttgcgccgcgctggcgcc
aagggcgagggacgctggcaggagctctcctgggacgacgcgctggacgagatcgccaat
gccttcgtcaaggccgaggcgcgggacggcagcgaggctgtctggccctattattacgcc
ggcaccatgggcctggtgcagcgcgacagcatcaatcgcctgcgccatgccaagcgctat
tccggcttcttctcctcgatctgcaccaatcccgcctggaccggcttcaccatggcgacg
ggcacgctgcgcggccccgatccccatgaaatgggccgtaccgactgcgtcgtcatctgg
ggcaccaatgccgtcgccacccaggtcaatgtgatgacccacgcggtgaagtcgcgcaag
gagcgcggcgctaagatcgtcgtcatcgatatctacgacaatccgacgatgaagcaggcc
gatctggcgctgatcgtcaagccgggcacggatgcggcgctggcctgcgccgtcatgcac
gtcgccttccgtgatggctatgccgaccgtgcctatatggctaaatttgccgacgatcct
gccggtctggaagcgcatttgcagacgaagacgccggaatgggcggcggctatcaccggc
ctgtcggtcgatgagatcgaagcctttgccaggctcgttggcaccacgaagaaatcctat
ttccgcctcggctacggcttcacccgccagcgcaacggtgccgtggccatgcatgcggcg
gcttcgatcgctaccgtgctcggctcctggcaatatgagggcggcggtgccttccattcc
aacagcgatatcttccgcatcgatggcagcgagctgaccggtcgttcgatgctggatcag
gatgtccgcatgatcgaccagtcgcagatcggccgggcgctcaccagcgatgccgtggcg
ctgcgccatcgcgggccggtgacggccatgctgatccagaacaccaatccggtgaacatc
gcgccggaacagcggctggtaaagcgcggctttgcccgcaacgacctcttcgtcgccgtg
cacgaacaattcatgaccgataccgccgaaatggccgatatcgtcattccggccaccatg
ttcgtcgagcatgacgatatctaccgtgccggcggccagaaccacattctgctcggcccc
aagctggtcgagccgccttcgaccgtgcgcagcaatctcttcgtcatcgaggaactggcc
aagcgccttggcgtcgccgatcgtcccggcttcggtttttccgcacgcgaaatggtggac
cgtatcctgtcggatagtggcctgccggattacgattattttctcgagcataaatggttc
gaccgtcagccggctttcgaggaagcgcatttcctcaacggttttgcccattccgacggc
aggttccgtttccgcccggactgggtcaaccagcccgctccgaaccgcccgccggaagcc
gttggcttgctcggcccgcacattgagctgccggagtttcccgatcaggtcgatgtcatc
gaagtcgccgatccggatcatcccttccggcttgccacctcgccggcacgcaatttcctg
aattcgagctttgcggagaccaagacctcgcgccagaaggaaggccgcccggaggtgatg
atcaatcccgcggacgccgcagcgcttgaggtcatcgaaggcgatctcgtccagatcggc
aatgtcaggggcgacatccgcctccatgcgcgcatcacgacggaggtaaagcccggcgtg
ttgatcgccgagggcctgtggccgaacaaggcgcatgtggatggcgaggggatcaatgtg
ctcaccggcgccgatcccgtcgcgccctatggcggcgcggctgtccacgacaacaaggtt
tggctgcgcaaggatgcgaaatga

DBGET integrated database retrieval system