KEGG   Agrobacterium radiobacter: Arad_1722Help
Entry
Arad_1722         CDS       T00850                                 

Definition
(GenBank) ADP-ribose pyrophosphatase protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:1362812..1363426
Genome map
AA seq 204 aa AA seqDB search
MAAQGCEMNKFEKAKVEIVSEKTLSDQWTRLSNYDIDYTDSSGETHRLKREIYHRTPAAC
ILLYDPKRETVILVRQFRLPAYLTGFPAWMIEVPAGLLDGDHPEEAIRREAMEETGFRVR
DIRFLFKTFTSPGAVTEIIHFFAAVVDTTDRIADGGGLADEHEDIEVLEVRLADAVAMIE
AGEIYDAKTVMLLQWAALNKASLG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
ttggctgcgcaaggatgcgaaatgaataagtttgaaaaggccaaggtcgagatcgtcagc
gagaagacgctctcggatcaatggacacggctcagcaactacgacatcgactatacggat
tccagcggcgagacgcaccggctgaagcgcgagatctatcaccgcacgccggccgcctgc
atcttgctctacgatcccaagcgcgagacggtcatcctcgtgcggcagttccgcctgccg
gcctatctcaccggctttcccgcctggatgatcgaagtgccggccggcttgctcgatggc
gatcatccggaagaggcgatccgccgcgaggcgatggaggaaaccggtttccgggtccgc
gatatcaggtttcttttcaagacattcacctcgcccggcgcggtcaccgaaatcatccat
ttcttcgccgctgtcgtcgacaccaccgaccgtatcgctgatggcggcgggcttgccgac
gaacatgaggacatcgaggtgctcgaagtccggctggccgacgcggtggcgatgatcgaa
gcgggcgagatctatgacgccaagacggtcatgttgctgcaatgggcggcactgaacaag
gcgagcttgggatag

DBGET integrated database retrieval system