KEGG   Agrobacterium radiobacter: Arad_1737Help
Entry
Arad_1737         CDS       T00850                                 

Definition
(GenBank) transcriptional regulator protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C_11 TetR_C_6
Motif
Other DBs
NCBI-ProteinID: ACM26098
UniProt: B9JCW1
Position
1:1381847..1382500
Genome map
AA seq 217 aa AA seqDB search
MKNSEDTKNSPQRKRGRPPAFDRETVLAAARDTFWKHGYDGSSIADLTAAMGITPQSLYA
AFSSKADLYREALEQYRRMPRPEPGNPLQETVDTVTAFDRFLRNAAGIFTAPEHPKGCMI
STAVLNCAEENEPVAHHVASMRLQTLDLFAARVERGIAEGDMRPDANARSLARFLGAIVQ
GMSVQARDGATREELLEIVAHARGELMRHRLGPGAVK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaatagcgaagacacgaaaaattccccccagcgaaagcgtggccgtccgccggcc
ttcgatcgtgagacggttcttgcggctgcgcgcgataccttctggaagcatggttatgac
ggctcgtccattgcggatctgaccgccgccatggggatcacaccgcagagcctttatgcc
gccttcagttcgaaggccgacctctaccgcgaggcgctggagcaatatcgacgcatgccg
cgacccgagccgggcaatcctttgcaggaaacggtggacaccgtcaccgcgttcgatcgc
tttctccggaatgctgccgggatattcaccgcgccagagcacccgaaaggctgcatgata
tcgacggctgtgctgaattgcgcggaagagaatgaaccggtggcccatcatgtcgcttcc
atgcgcctgcagacgctggatctgtttgcggcacgggtcgagcgtggcatcgcggagggg
gatatgcgaccggatgcgaatgcacggtcactggcccgctttctcggagcgatcgtgcag
ggcatgtccgttcaggcgcgggacggtgcgaccagggaggagctgctcgagatcgtcgct
catgcccgaggtgagctgatgcggcatcggcttgggccgggcgcggtgaaatga

DBGET integrated database retrieval system