KEGG   Agrobacterium radiobacter: Arad_1740Help
Entry
Arad_1740         CDS       T00850                                 

Gene name
parC
Definition
(GenBank) DNA topoisomerase IV, A subunit
  KO
K02621  topoisomerase IV subunit A [EC:5.99.1.-]
Organism
ara  Agrobacterium radiobacter
Brite
Enzymes [BR:ara01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.-  
     Arad_1740 (parC)
DNA replication proteins [BR:ara03032]
 Prokaryotic Type
  DNA Topoisomerases
   Arad_1740 (parC)
Chromosome and associated proteins [BR:ara03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Arad_1740 (parC)
Prokaryotic defense system [BR:ara02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Arad_1740 (parC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C
Motif
Other DBs
NCBI-ProteinID: ACM26100
UniProt: B9JCW3
Position
1:1383980..1386238
Genome map
AA seq 752 aa AA seqDB search
MGKNLLPPGGGDDDSIVPVDLKAALEERYLAYALSTIMHRALPDVRDGLKPVHRRIVYAM
SEMGLRPNAAFRKCAKIVGEVMGNYHPHGDQSIYDALARLAQDFSQRYTLVNGQGNFGNI
DGDSPAAMRYTESKMTAVSELLLEGIDQDAVDFRDTYDESNSEPIVLPGAFPNLLANGSS
GIAVGMATSIPSHNAHELCDAALHLIKDRDATVETLVELYIPGPDFPTGGIIIDDRRSII
ESYKTGRGGFRVRAKWEIEDLGRGGYQIVITEIPFQVQKSRLIEKIAELLLARKLPLLED
IRDESAEDIRVVLIPKSRTVDATILMESMFKLSELESRFPLNMNVLSMGRIPKVMALNEV
LKEWLDHRREVLQRRSRFRLAAIEKRLEILGGFLIAYLNIDEVIAIIREEDEPKPVMMER
FGLTDNQVEAILNMRLRSLRKLEEFEIRKEFDGLSKEKSEIEVLLASDEKQWQTVAWEIG
EVKKKFAKATEVGRRRTQFAEAPEADDAALQQAMIEKEPITVVVSEKGWIRALKGHISET
STLTFKEGDALKVAFPAQTTDKILIITTGGKAYTLGGDKLPGGRGHGEPLRIMVDMENDQ
DVLTAFVHDPQRKQLVASTAGNGFVVAETELVANTRKGKQIMNLTTPDETKLLVPVSGDH
VAVVGENRKMVVFPLSQIPEMSRGKGVRLQRYKDGGVSDIKCFAIADGLTWEDSAGRTFT
KTKDELAEWLGDRSAAGRAVPKGFPRTGRFSG
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaatcttttaccgcctggtggcggcgacgacgacagcatcgttccggtcgac
ctgaaggccgcgctcgaagagcgctatctggcctatgccttgtcgacgatcatgcatcgc
gcgcttccggatgttcgtgacggcctgaagccggttcatcgccgcattgtttatgcaatg
agcgagatgggcctgcgccccaacgccgctttccgcaaatgcgccaagatcgtcggcgag
gtgatgggtaactatcacccgcacggcgaccaatcgatctatgatgcgctggcccgtctg
gcgcaggatttctcgcagcgctatacgctggtcaacggccagggcaatttcggcaatatc
gacggcgatagcccggccgcgatgcgctacaccgaatccaagatgacggcggtctccgaa
ctgctgcttgaaggcatcgaccaggatgccgtggatttccgcgacacctatgacgagtcg
aattccgaaccgatcgtcctgcccggcgccttcccgaacctgctcgccaacggttcctcc
ggcattgctgtgggcatggcgacctcgatcccgtcgcacaacgcccatgagctttgcgac
gcagcgctgcatttgatcaaggatcgcgatgccaccgtcgagacgctggtggagctctat
attccaggcccggactttccgaccggcggcatcatcatcgatgatcgccggagcatcatc
gaaagctacaagaccggccgcggcggatttcgcgtccgtgccaaatgggagatcgaggat
ctcggccgtggtggctaccagatcgtcatcacggaaattccgttccaggtgcagaagtcc
cgtctgatcgaaaagatcgccgagctgcttctggcgcgcaagctgccgctgctcgaggac
attcgcgatgagtccgccgaggacatccgcgttgtcctgatcccgaagagccgcaccgtc
gatgcgacgatcctgatggaatcgatgttcaagctctcggagctggaaagccgcttccca
ctcaatatgaacgtcctgtccatgggccgcatcccgaaggtcatggcgctgaacgaggtg
cttaaggagtggctcgaccatcgccgcgaagtcttgcagcgccgctcgcgcttccggctc
gcggcaatcgagaaacgcctggaaattctcggcggcttcctgatcgcctacctcaacatt
gacgaggtcatcgccatcatccgcgaggaggatgagccgaagcctgtgatgatggagcgg
ttcgggctcacggacaatcaggtcgaagcgatcctcaacatgagactgcgctccttgcgc
aagctcgaggaattcgaaatccgcaaggagttcgacggcctcagcaaggaaaagtccgag
atcgaggtattgctcgcctccgacgaaaagcagtggcagacggtcgcctgggaaattggc
gaggtgaagaagaagttcgccaaggcgaccgaagtcggccgccgccgcacgcaatttgcc
gaagcgcccgaggccgatgatgcggcactccagcaggcgatgatcgagaaggaaccgatc
actgtcgtcgtttcggaaaagggctggatccgcgcgctgaagggccacatctccgagacc
tcgacgctgaccttcaaggaaggcgacgcgctgaaggtggccttcccggcgcagacgacg
gacaagatcctgatcatcaccactggcggcaaggcctatacgctcggcggcgacaagctg
cccggcgggcgcggtcatggtgagccgttgcgcatcatggtcgacatggagaacgaccag
gacgtgctgactgccttcgtccacgatccgcagcgcaagcagctcgtcgcttcgaccgcc
ggcaacggttttgtcgtagcggaaacggaactggtcgccaatacccgtaagggcaagcag
atcatgaacctcacgacgccggacgagacgaagctgctcgtgcccgtctccggcgatcat
gtcgccgtcgtcggcgagaaccgcaaaatggtggttttcccgctgtcgcagattccggaa
atgtcgcgcggcaaaggcgtgcgcctgcagcgctacaaggacggcggtgtctccgatatc
aagtgcttcgccatcgctgacggtctgacctgggaagacagcgccggccgcaccttcacc
aagacgaaggacgagctggccgaatggctgggcgatcgttctgccgccggccgtgctgtg
ccgaagggcttccccaggacgggtaggttttcggggtga

DBGET integrated database retrieval system