KEGG   Agrobacterium radiobacter: Arad_1775Help
Entry
Arad_1775         CDS       T00850                                 

Definition
(GenBank) hypothetical protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(1407677..1407961)
Genome map
AA seq 94 aa AA seqDB search
MAFKILSVCLLAVGMGTTAMAASSDHGGGDRGGWGDSPGAEDNNNYRSTIIDRSDTAGRD
EKDPNACWTLPRSADGKSIVAPSQANPIVPRKCN
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaaaatcttaagcgtatgcctgctcgccgtcggcatgggcacgacggcaatg
gccgcctccagtgaccacgggggcggcgatcgaggcggctggggagatagccctggtgcc
gaagacaacaacaactatcgcagtaccatcatcgacagaagcgacaccgccggtagggac
gaaaaagatccgaatgcctgctggacgctgccacgctctgccgacggcaaatccattgtc
gcgccgagccaggctaatcccatcgttccgcgcaagtgcaattga

DBGET integrated database retrieval system