KEGG   Agrobacterium radiobacter: Arad_1781Help
Entry
Arad_1781         CDS       T00850                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BA14K
Motif
Other DBs
NCBI-ProteinID: ACM26133
UniProt: B9JCZ6
Position
1:1410497..1410886
Genome map
AA seq 129 aa AA seqDB search
MRVITRSMAVAGLGLLLAASAVLPASAITMPALSAPEQGSDIIQVRGHGHWHSHNHWRGG
HKRHGSDSYYDDDSDSGVLFKSFVTGTLFYRQHAERYDGHARACASRYQSYRASDNTYQP
NHGPRRQCR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgatcaccagatccatggctgtcgccggtctcggcctattgctggccgcaagc
gcggtcttgcccgccagcgccatcaccatgcccgcgctttcggcgccggagcaagggtcc
gatatcatccaggttcgcggccatgggcactggcatagccacaaccattggcgcggtggc
cacaaacgccacggctccgacagctattacgacgacgactcggatagcggcgtgcttttc
aagtcattcgtgaccggcacgctgttctacaggcagcacgcggaacgctacgacggtcac
gcacgagcctgcgccagccgctaccaatcctaccgggcgtcggacaacacttaccagccg
aaccatgggccacgccgacaatgcaggtga

DBGET integrated database retrieval system