KEGG   Agrobacterium radiobacter: Arad_1782Help
Entry
Arad_1782         CDS       T00850                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNase
Motif
Other DBs
NCBI-ProteinID: ACM26134
UniProt: B9JCZ7
Position
1:complement(1411116..1411763)
Genome map
AA seq 215 aa AA seqDB search
MWLWGVVGLAAVAGIFAYEHRREMPTLLANAGATGARHVSQVTEAVQAAPTPAVRPKVRT
AVVVPERPDTTMPVPPNAIPVSLPMERAAPVLATAPVHENGGRFGLCGSATGANCVVDGS
TFWQNGVRIRLADIDVPDIAPSHCAGEQQKGTAAKLRLQALLNDGTFALSGSARGEDQHG
GKFRIAMRAGRSIGDQLVSEGLARRWTGQTPSWCS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtggctatggggcgtggttggcctcgccgcagtagccggcatcttcgcctatgagcac
cgccgggaaatgccgacacttctggccaatgccggcgccacaggcgcccggcatgtatcg
caggtgacagaggcagtacaggccgcgccgacgccggctgtaagaccgaaggtcaggacg
gctgtcgtcgttccggaacgcccggacacgacaatgccggttccgcccaacgccattccc
gtatccttgccaatggaacgcgcggctccagtgctggccaccgctcctgtccacgaaaac
ggcggccgattcggcctatgtggcagcgcgactggcgccaactgtgtcgtcgacggcagc
accttctggcaaaatggggtcaggatccgtctggcggatatcgatgtgcctgacatcgcc
ccctcccactgcgccggtgaacaacaaaagggcaccgccgcgaagctgcgcctgcaggcg
cttctcaacgacggcacgttcgcactctccggcagtgcccgcggcgaggatcaacatggc
ggcaaattccgcatcgccatgcgcgccggccgctccatcggcgatcagctggtgtccgaa
gggctcgcacgccgctggacaggacagacgccatcctggtgcagctaa

DBGET integrated database retrieval system