KEGG   Agrobacterium radiobacter: Arad_1784Help
Entry
Arad_1784         CDS       T00850                                 

Definition
(GenBank) polyhydroxybutyrate depolymerase protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Esterase_phd Peptidase_S9 Abhydrolase_1 Hydrolase_4 Abhydrolase_6 AXE1 Esterase Abhydrolase_2 Abhydrolase_3 Peptidase_S28 DLH
Motif
Other DBs
NCBI-ProteinID: ACM26136
UniProt: B9JCZ9
Position
1:1412497..1413513
Genome map
AA seq 338 aa AA seqDB search
MNFKVPSRLRRLLVDSVELPQLKFPVTRPRSQPARQRVSTQLVPQSLTEVLWFGRNPGDL
RMLEYVPPGVEGPMPLVVVLHGCQQNAEDFDRASGWTALARKHGFAVLYAEQKSFNNPNL
CFNWFRPSSVTRDRGELGSIREMIDFSRRLHKIDDNRIFVMGLSAGGAMASALLATYPDL
FAAGAIISGLPFGAARDAMSALDVMRRGSARPAEKWAELVREVSPDAVRFPSVSIWHGSD
DGTVSYANAEASVAQWLAVHERPQTKGRLRLFEGGERREWRGEHGDVVVELVTLNDFGHG
LPARSIVAGKEPANDTERFILPAAISAPEQLVQSWKLV
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcaaggttccgagccggctgcgccgtttgctcgtcgattccgtcgagttgcca
cagctcaagttccccgtaacgcggccgcgctcgcagccggcacgtcagcgcgtatccacg
cagctcgtgccgcagagcctgacggaggtcctgtggttcgggcgcaatccgggtgaccta
cgcatgctcgaatatgtgccgccgggcgtcgaggggccgatgccgcttgtcgtcgtcctg
catggctgtcagcagaatgccgaggatttcgatcgtgccagcggctggacagccttggcg
cgcaagcatggcttcgctgttctttatgccgagcagaagtcgttcaacaatcccaatctc
tgtttcaactggttccgcccgagttcggtcacgcgcgatcgcggcgaactgggttcgatc
cgcgagatgatcgatttcagccgccggctgcacaagatcgacgacaacaggattttcgtc
atgggcctttcggccggtggcgcgatggcgtcggcgctgcttgccacctatccggacttg
tttgctgccggtgccatcatcagtggcctgccttttggtgcggcacgcgatgctatgtcg
gcgctggatgtgatgagaagaggctcggcgcgtccggccgaaaaatgggccgaacttgtc
cgcgaagtctcgccggatgccgttcggttcccgtcggtctccatctggcatggatctgac
gacggcaccgtctcatatgccaatgcggaggcatcggtggcgcagtggctggcggtgcat
gaacgtccgcaaacgaaaggccggttgcgcctgttcgaaggcggcgagcggcgcgaatgg
cgaggcgagcacggcgacgtggtggtggaactggtaacactcaatgatttcggccacggc
ctgccggctcgatccatcgtcgcgggcaaggagccggctaatgataccgagcgcttcatc
ctgccggccgccatctcggcgccggagcagctcgttcaaagctggaagctggtgtag

DBGET integrated database retrieval system