KEGG   Agrobacterium radiobacter: Arad_1793Help
Entry
Arad_1793         CDS       T00850                                 

Definition
(GenBank) glycosyltransferase protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(1417118..1418680)
Genome map
AA seq 520 aa AA seqDB search
MNPIEKSKQFDLDHIRKQVSEIRARSAEEKGGENLSGDINAYARQIAEQFREGNQTPAII
IGQYRLFEFLWLLVVGLAVLFFLTAPGDHSFLAKTTVTISLSTLTIIFLQVADAYQIPML
RLPHRFLQRILLPWVAAFAVVAIALVPFHVDGVYSVRLLTTWFVAGAIFLVGARLMFAYG
IRHWARNGIMERRAVIVGGGEPAKELIRALEHQPDNDIRICGIFDDRGEKRSPVMVAGYP
KLGTVPELVEFARLTRVDMLIIALPMSAEDRILQLLKMLWVLPADIRLAAHANKLRFRPR
AYSHVGAVPMLDIFNKPIRDWDGVAKRIFDVFFSLLALSLLWPVMLAAAIAVKTTSKGPV
FFMQKRHGFNNEIIKVLKFRSMYTHMSDPTARNAVTKNDPRVTPVGRFIRKTSVDELPQL
FNVLLGNLSLVGPRPHAVLAASHNRTYADVVEGYFARHRVKPGVTGWAQINGWRGEIDSD
DKIKFRTAYDLYYIENWSLFFDLKILFLTPFRLLNTENAY
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccatcgagaagtccaagcaatttgacttggaccatattcgcaagcaggtttcg
gaaatccgcgcccgcagcgccgaggaaaagggcggcgagaatctgtccggcgacatcaat
gcctatgcccgccagatcgccgagcaatttcgcgaaggcaaccagacaccggcgatcatc
atcggccagtatcggctcttcgaattcctgtggctgctcgtcgtcggacttgcggttctc
ttcttcctgacagcaccgggcgatcattcctttctggcgaagacaacggtaacgatctcg
ctcagcacgctcaccatcatctttctgcaggtggctgacgcctatcaaatcccgatgcta
cgcctgccgcaccgcttcctgcagcgcatcctgctgccatgggtggcggcgttcgcggtg
gtcgccattgccctcgtgccgttccatgtcgatggcgtctattctgtccgccttctcacc
acctggtttgtcgccggcgcgattttccttgtcggcgcgcgcctgatgttcgcctatggc
atccgccactgggctcgcaacggcatcatggagcggcgcgccgtcatcgtcggcggcggc
gagccggccaaggaactgatccgcgcgctcgagcatcaacccgataacgatatccgcatc
tgcggcatcttcgacgatcgtggcgagaagcggtcgccggtgatggtggccggctatccg
aaactcggcactgtccccgagctggtcgaatttgcccggctgacccgggtcgacatgctg
atcatcgcgctgccgatgagcgccgaagaccgtattctgcagctcctgaagatgctctgg
gtgctgcccgccgatatccgcctggcggcgcatgccaacaagctgcgcttccgcccgcgc
gcctattcgcatgtcggcgcggtgccgatgctcgacatcttcaacaagccgatccgcgat
tgggatggcgtcgccaagcgcatcttcgatgtcttcttcagcctgctcgcgctgtccctg
ctctggccggtcatgcttgccgcagcgatcgcggtgaagacgacctcgaaggggccggtc
ttcttcatgcagaagcgtcacggcttcaacaacgagatcatcaaggtcctcaagttccgc
tcgatgtacacgcatatgagcgacccgacggcccgcaacgccgtcaccaagaacgacccc
cgcgtcacgccggtcggccgcttcatccgcaagacctcggtcgatgagctgccgcagctc
ttcaatgtgctgctcggcaacctgtcgctcgtcggcccgcgtccgcatgccgtgctggcg
gcgagccataaccgcacctatgccgatgtggtcgagggttatttcgcccgccatcgcgtc
aagcccggcgtcaccggctgggcgcagatcaacggctggcgcggcgagatcgacagcgac
gacaagatcaagttccgcacggcctatgacctctattacatcgagaactggtcgctgttc
ttcgatctgaagatcctgttcctgacgcccttccgtcttctgaacacggaaaacgcctat
tga

DBGET integrated database retrieval system