KEGG   Agrobacterium radiobacter: Arad_1796Help
Entry
Arad_1796         CDS       T00850                                 

Definition
(GenBank) polysaccharide export system protein
  KO
K01991  
polysaccharide biosynthesis/export protein
Organism
ara  Agrobacterium radiobacter
Brite
Transporters [BR:ara02000]
 Other Transporters
  Pores ion channels [TC:1]
   Arad_1796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(1419915..1420490)
Genome map
AA seq 191 aa AA seqDB search
MSFAKPKIVLALGMAAVSAALSGCNTYQPAPKAFSEATIQPYMLDSGDRLRVTVFDQEGL
TNTYTVDQAGYISFPLIGQVPARGRTLQQLSGQIAQKLRQGYIRDPDVTIDIDRYRSVYI
MGEVGQPGQYSYVPGMTIQNAIAVAGGFSSRANQANADVTRKINGHVMTGRVGISDPVLA
GDTIYVRERLF
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgcaaagccaaagattgtcctggcactcggcatggcagccgtgagcgccgcg
ctcagcggctgcaacacctatcagcctgcgccgaaagccttcagtgaagcgacgatccag
ccctatatgctggatagcggcgatcgcctgcgcgtgaccgtcttcgatcaggaaggcctg
accaacacctatacggtcgaccaggccggctacatctccttcccgctgatcggccaggtc
cctgcccgcggccgcacgctgcagcagctttccggccagatcgcccagaaacttcgccag
ggctacatccgcgaccccgatgtcaccatcgacatcgaccgctaccgctcggtctacatc
atgggcgaagtcggccagcccggccagtattcctacgtcccaggcatgacgatccagaac
gccatcgcggttgccggcggcttcagcagtcgcgccaaccaggccaatgccgacgtgacc
cgcaagatcaacggtcatgtcatgacaggtcgggtcggcatctcggatccggtgctggcg
ggcgatacgatctatgtccgcgaacggctgttctga

DBGET integrated database retrieval system