KEGG   Agrobacterium radiobacter: Arad_1807Help
Entry
Arad_1807         CDS       T00850                                 

Definition
(GenBank) hypothetical protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACM26152
UniProt: B9JD15
Position
1:1429345..1429983
Genome map
AA seq 212 aa AA seqDB search
MKESAPAKVGSLAADVRLVAVKAWSIDVLGTEFSYVYAESTGWLDARKHACLQGFKQRAF
LSLLFTGRSRALIGLLDASDLRRGAFSFSVGKRADRALIRELLAIRIGLYEFLHAFHLRL
LLRRRLRSVRRKGRRGARYCKQKWQDQSSYRPCHPKAPPWVMREFAIKCALCLHGDVVSV
KKAQEKQKKAGQSPAFRRRFRFSSAGATKRIA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagagcgcgccggcaaaggtcgggtcgctggccgccgatgtcaggctggtcgct
gtaaaggcatggtcgatcgacgtgctcggcacggagttctcctacgtttatgctgaaagc
acaggctggctcgatgcgcgcaagcatgcatgcctgcaaggcttcaaacagagggctttc
ctgtctctgttatttactggccggagccgagcattgataggcctgcttgacgcaagcgat
ttgcggcgtggagcattcagcttttccgtcggcaagcgtgcagacagagcattgatccgt
gaactccttgcaatccggattggcctgtatgaattccttcatgctttccatctgcgtttg
ctcttgcggcgtcggctgcggagcgtccgccgaaagggcaggcgaggtgcccgatattgc
aagcagaaatggcaggatcaatccagctatcgtccgtgtcatcctaaggctcctccatgg
gtgatgcgcgagtttgccataaaatgcgcgctttgcctgcatggcgatgtggtatccgtc
aaaaaagcccaggaaaaacaaaaaaaggccgggcagagcccggcctttcgtcgtcgtttc
aggttctcttctgcaggcgccacaaagagaatagcgtga

DBGET integrated database retrieval system