KEGG   Agrobacterium radiobacter: Arad_1810Help
Entry
Arad_1810         CDS       T00850                                 

Gene name
rpsI
Definition
(GenBank) 30S ribosomal protein S9
  KO
K02996  small subunit ribosomal protein S9
Organism
ara  Agrobacterium radiobacter
Pathway
ara03010  Ribosome
Module
ara_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ara00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Arad_1810 (rpsI)
Ribosome [BR:ara03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Arad_1810 (rpsI)
  Bacteria
    Arad_1810 (rpsI)
  Archaea
    Arad_1810 (rpsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S9
Motif
Other DBs
NCBI-ProteinID: ACM26154
UniProt: B9JD17
Position
1:complement(1431402..1431875)
Genome map
AA seq 157 aa AA seqDB search
MIMADLSSLKDLGTVSEAAAPVHVRKVDSLGRSYATGKRKDAVARVWLKAGSGKIIVNGK
DYTAYFARPVLQMILRQPIVAAARDGQFDIIATVAGGGLSGQAGAVRHGLSKALTYFEPG
LRSVLKKGGFLTRDSRVVERKKYGRAKARRSFQFSKR
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
ctgataatggctgatctctcttccctgaaggatctcggcacggtatcggaagcagctgct
cccgttcacgtccgcaaggttgactcgctcggtcgctcctacgcgaccggcaagcgcaag
gacgcagttgcccgcgtatggctcaaggccggctctggcaaaatcatcgtcaacggcaag
gactacacggcatatttcgcccgtccggttctgcagatgatcctgcgccagccgatcgtc
gctgctgcccgtgatggccagttcgacatcattgctaccgttgccggtggcggtctctcc
ggccaggccggtgctgttcgtcacggcctgtccaaggctctcacctacttcgaaccgggc
ctgcgctcggtcctgaagaagggtggcttcctgacccgcgacagccgcgttgtcgagcgt
aagaagtacggccgtgcgaaggcacgtcgctcgttccagttctccaagcgttaa

DBGET integrated database retrieval system