KEGG   Agrobacterium radiobacter: Arad_1813Help
Entry
Arad_1813         CDS       T00850                                 

Definition
(GenBank) transporter
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA CRT-like Mg_trans_NIPA TPT
Motif
Other DBs
NCBI-ProteinID: ACM26156
UniProt: B9JD19
Position
1:complement(1432575..1433411)
Genome map
AA seq 278 aa AA seqDB search
MSLDVIALVLLGAMLHATWNAIIKAGTDKSLDAALVAAGGAITALPFLSFLPLPASAAWP
FIGASAILQFAYFQLVAAAYRAGDIGLVYPLMRGVAPMIIAATSGFILKESLSGGAILGI
MTICAGIMTLAFEARKGGRTAIKLALSNSVVIATYTYVDGIGARLSGNSISYTLWMALLP
PVLLFTWAISQRGVNAVAAHVRYNWWRGLIGGAGSIASYGLALWAMTKAPVATVAALRET
SILFALVISVVILKERSSIWRYIAGAIIAAGVLILKLV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgtctcttgacgtcatcgctctcgtccttctcggtgccatgctgcacgcgacctggaat
gcgatcatcaaggccggcaccgataaatcgctggatgcggctctggtcgcagccggcggc
gcaatcaccgccctgcccttcctgtcgtttctgccgttgcccgcctcggccgcctggccc
ttcatcggcgcgtcggcgatcctgcaattcgcctatttccaactggtggccgccgcctat
cgcgccggtgatatcggcctcgtctacccgctgatgcgcggcgttgcgccgatgatcatc
gcggcgaccagcggcttcatccttaaggagagcctgtcgggtggagccatcctcggcatc
atgaccatctgcgcgggcatcatgacgctggccttcgaggcacggaagggcggccggaca
gccatcaagctcgcgctttccaattccgtggtgatcgccacctatacctatgtcgacggc
atcggggcacggctatcgggcaattccatatcctatacgctgtggatggcgctgctaccg
cccgtgctgctgttcacctgggcgatctcgcagcgcggagtgaatgccgtggccgctcat
gtccgctacaactggtggcgcggcctgatcggcggcgccggttccatcgcatcctacggc
ctggcgctatgggccatgacgaaggcgcccgtcgccaccgtcgcggcattgcgcgaaacc
tcgatcctgttcgcgctggtgatttccgtggtcattctgaaggagcgatccagcatttgg
cgctacattgccggcgcgattattgccgcgggcgttctgattctgaagctggtttga

DBGET integrated database retrieval system