KEGG   Agrobacterium radiobacter: Arad_2107Help
Entry
Arad_2107         CDS       T00850                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ara  Agrobacterium radiobacter
Brite
Enzymes [BR:ara01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Arad_2107 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1659784..1660455
Genome map
AA seq 223 aa AA seqDB search
MMDFEAARVKMVENQIRTTDVTSHSVLNAFLTVPRENFVPEKSKLLAYVDNDIEVCPAAA
GTPARFLMEASPLAKLLQLGAITKEDKVLDVGCGTGYVSALLSILAGKVVALESDEALAA
TAKTNLAALGHDNVTVVTGELEKGYAASGAYDVIFVDGSVQEVPQALLDQLGEGGRLIVV
LGYGHAARATVFMRERGALSENVFFNASIKPLPGFAKAKEFVF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatggatttcgaagcagcacgcgtgaagatggtcgagaaccagatccgcacgacggat
gttacctcccattccgtgttgaatgcgtttctgacggtgccgcgcgaaaatttcgtgccg
gagaagtcgaagctcctggcctatgtcgacaatgatatcgaggtctgtccggcggctgca
ggcacgccggcgcgcttcctgatggaagcgtcgccgctggcaaagctcttgcagctcggc
gcgatcaccaaggaagacaaggttctcgatgtcggttgcggcacgggttacgtctcggcg
ctcctgtcgatcctggccggcaaggtcgtcgcgctcgaatccgacgaggcgctggccgct
acggccaagaccaatctcgcagcgctcggccatgacaacgtcacggtcgttaccggcgag
ctggaaaagggctatgccgccagcggcgcctacgatgtcatttttgtcgatggttcggtt
caggaagtgccgcaggcactgctcgatcagctcggcgaaggcggtcgtttgatcgtggtg
ctgggctatggccatgccgcccgcgccaccgtcttcatgcgcgagcgcggagctctttcg
gaaaacgtcttcttcaatgcgtcgatcaagccactgccgggctttgccaaggccaaggaa
ttcgtgttctga

DBGET integrated database retrieval system