KEGG   Agrobacterium radiobacter: Arad_2249Help
Entry
Arad_2249         CDS       T00850                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00010  Glycolysis / Gluconeogenesis
ara00020  Citrate cycle (TCA cycle)
ara00620  Pyruvate metabolism
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01120  Microbial metabolism in diverse environments
ara01130  Biosynthesis of antibiotics
ara01200  Carbon metabolism
Module
ara_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arad_2249
   00020 Citrate cycle (TCA cycle)
    Arad_2249
   00620 Pyruvate metabolism
    Arad_2249
Enzymes [BR:ara01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Arad_2249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 DUF2118 QRPTase_N GCV_H
Motif
Other DBs
NCBI-ProteinID: ACM26482
UniProt: B9JEZ1
Position
1:1776724..1778061
Genome map
AA seq 445 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIL
VPAGTEGVKVNALIAVLAGEGEDVAAAASGAGAAPAAAPKAEAAPVAVAPAATPAPVASA
APAVASAPVATDGQRTFASPLARRLAKDAGIDLTALVGSGPHGRVIKKDIEAAAAGGGVA
KAAPAAQPAAAPAPALAKGQSDDAVLKLFEPGSYELVPHDGMRKTIAKRLQESKQTIPHF
YVTVDCELDALLALRTQLNDAAPKSKDGVPAYKLSVNDMVIKALALALRDVPDANVSWTD
SNMVKHKHADVGVAVSIPGGLITPIIRSAELKTLSAISNEMKDYGKRAKERKLKPEEYQG
GTTAVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVIVRKGEMVVATVMSVTLSTDHRA
VDGALGAELLGAFKGYIENPMGMLV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcaacatcaccatgcctgccctctcaccaaccatggaagagggcaacctcgcc
aagtggctggtcaaggaaggcgacaaggtcaagtccggtgacgtcatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagccgtggatgaaggtacagttgccaagatcctc
gttcccgccgggaccgaaggcgtcaaggtcaacgcgctgatcgcggttctggccggcgaa
ggcgaggatgttgcagcggctgcttccggcgctggtgcggctccggccgcggcgccaaag
gcagaagctgcgcctgttgctgtcgctcctgcggcaacgcctgctccggtggcctcggcc
gctcctgccgtggcatcggctccggtagcgacggatggtcagcgcaccttcgcatcgccg
cttgcccgtcgccttgccaaggacgccggcattgatctgaccgcgcttgtcggctccggc
ccgcacggccgggtgatcaagaaggacatcgaagccgctgctgccggcggtggtgttgcc
aaggccgctccggctgcccagcctgcagctgccccggcacccgctttggcaaagggccag
tcggacgatgccgttctcaagctgttcgagcccggttcctacgaactcgtgccgcatgac
ggcatgcgcaagaccattgccaagcgcctgcaggaatctaagcagaccatcccgcatttc
tacgtcactgtcgattgcgagctggatgcattgctggcgctgcgcacgcagctcaatgat
gccgctccgaagtcaaaggacggcgttccggcctacaagctctctgtcaacgacatggtc
atcaaggccctggcgctggctctgcgcgacgtgccggacgcgaacgtttcctggaccgac
agcaacatggtcaagcacaagcatgccgatgtcggcgttgccgtttccatcccgggcggc
ctgatcacgccgatcattcgcagcgccgagctgaagaccctgtctgccatctccaacgag
atgaaggactacggcaagcgcgccaaggagcgtaagctgaagcccgaggaatatcagggc
ggcaccaccgccgtgtccaacatgggcatgatgggcgtcaagaacttcgccgccgtcgtc
aatccgccgcatgcgaccatcctcgctgtgggcgcgggtgagcagcgggtgattgtccgg
aagggcgaaatggttgttgccaccgtgatgagcgtcacgctgtcgaccgaccatcgcgcc
gtcgacggcgcactcggcgccgaactcctgggcgccttcaagggctacatcgaaaacccg
atggggatgctcgtctga

DBGET integrated database retrieval system