KEGG   Agrobacterium radiobacter: Arad_2459Help
Entry
Arad_2459         CDS       T00850                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00010  Glycolysis / Gluconeogenesis
ara00051  Fructose and mannose metabolism
ara00562  Inositol phosphate metabolism
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01120  Microbial metabolism in diverse environments
ara01130  Biosynthesis of antibiotics
ara01200  Carbon metabolism
ara01230  Biosynthesis of amino acids
Module
ara_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arad_2459 (tpiA)
   00051 Fructose and mannose metabolism
    Arad_2459 (tpiA)
   00562 Inositol phosphate metabolism
    Arad_2459 (tpiA)
Enzymes [BR:ara01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Arad_2459 (tpiA)
Exosome [BR:ara04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Arad_2459 (tpiA)
  Exosomal proteins of bladder cancer cells
   Arad_2459 (tpiA)
  Exosomal proteins of melanoma cells
   Arad_2459 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACM26643
UniProt: B9JFF3
Position
1:complement(1945128..1945856)
Genome map
AA seq 242 aa AA seqDB search
MNGTRASLDQIKAIAEGVKAPLSERIDTLLCPPATLLYVATALCDDSPLAIGAQDCHQLV
SGAHTGDISAEMIADCFGTHVIVGHSERRRNHVESDALVRAKAEAALNADLIAIVCIGET
AEERDNAQTLDVLKRQLAGSVPDGSVSETTVIAYEPVWAIGTGKVPTRADVEEAHAFIRG
ELVERFGEDGKKFRLLYGGSVSGANAADLLSVANVNGLLVGGQSLKAVDFLAIYGAFERQ
FA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcacgcgcgccagcctcgaccagatcaaggcgatcgcggaaggggtgaaggcg
ccgttgtcggagaggatcgacacgctgctctgcccaccggcaacactcctctatgtcgcg
acggctctctgcgacgatagcccgctggcgattggcgcgcaggactgccatcagctggtc
agcggcgcgcatacgggcgatatttccgccgaaatgattgccgattgcttcggcacccac
gttatcgtcggccattccgaacgccgcagaaatcatgtggaaagcgacgcattggtgcgc
gccaaggcggaagcggcgctcaacgccgatctgatcgcgatcgtctgcatcggcgagacg
gcggaagagcgcgacaatgctcagacacttgacgtgctcaagcgccaactcgccggttcg
gttccagacggttccgtctcggaaacgaccgtcatagcctatgaacccgtttgggcaatc
ggcaccggtaaggttccaacgcgcgccgatgttgaagaagcccacgccttcatccgcggc
gaactcgtggaacgcttcggcgaggacggcaaaaagttccgtcttctctacggcggctcg
gtcagcggcgcgaatgcggcggacctgctttcggtcgcaaatgtcaacggtttgctcgtc
ggtgggcaaagcttgaaagccgtcgacttcctcgccatctatggcgcattcgaacggcag
ttcgcctga

DBGET integrated database retrieval system