KEGG   Agrobacterium radiobacter: Arad_2459Help
Entry
Arad_2459         CDS       T00850                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ara  Agrobacterium radiobacter
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arad_2459 (tpiA)
   01230 Biosynthesis of amino acids
    Arad_2459 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arad_2459 (tpiA)
   00051 Fructose and mannose metabolism
    Arad_2459 (tpiA)
   00562 Inositol phosphate metabolism
    Arad_2459 (tpiA)
Enzymes [BR:ara01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Arad_2459 (tpiA)
Exosome [BR:ara04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Arad_2459 (tpiA)
  Exosomal proteins of bladder cancer cells
   Arad_2459 (tpiA)
  Exosomal proteins of melanoma cells
   Arad_2459 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1945128..1945856)
Genome map
AA seq 242 aa AA seqDB search
MNGTRASLDQIKAIAEGVKAPLSERIDTLLCPPATLLYVATALCDDSPLAIGAQDCHQLV
SGAHTGDISAEMIADCFGTHVIVGHSERRRNHVESDALVRAKAEAALNADLIAIVCIGET
AEERDNAQTLDVLKRQLAGSVPDGSVSETTVIAYEPVWAIGTGKVPTRADVEEAHAFIRG
ELVERFGEDGKKFRLLYGGSVSGANAADLLSVANVNGLLVGGQSLKAVDFLAIYGAFERQ
FA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcacgcgcgccagcctcgaccagatcaaggcgatcgcggaaggggtgaaggcg
ccgttgtcggagaggatcgacacgctgctctgcccaccggcaacactcctctatgtcgcg
acggctctctgcgacgatagcccgctggcgattggcgcgcaggactgccatcagctggtc
agcggcgcgcatacgggcgatatttccgccgaaatgattgccgattgcttcggcacccac
gttatcgtcggccattccgaacgccgcagaaatcatgtggaaagcgacgcattggtgcgc
gccaaggcggaagcggcgctcaacgccgatctgatcgcgatcgtctgcatcggcgagacg
gcggaagagcgcgacaatgctcagacacttgacgtgctcaagcgccaactcgccggttcg
gttccagacggttccgtctcggaaacgaccgtcatagcctatgaacccgtttgggcaatc
ggcaccggtaaggttccaacgcgcgccgatgttgaagaagcccacgccttcatccgcggc
gaactcgtggaacgcttcggcgaggacggcaaaaagttccgtcttctctacggcggctcg
gtcagcggcgcgaatgcggcggacctgctttcggtcgcaaatgtcaacggtttgctcgtc
ggtgggcaaagcttgaaagccgtcgacttcctcgccatctatggcgcattcgaacggcag
ttcgcctga

DBGET integrated database retrieval system