KEGG   Agrobacterium radiobacter K84: Arad_2476Help
Entry
Arad_2476         CDS       T00850                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ara00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1960820..1961443
Genome map
AA seq 207 aa AA seqDB search
MDAIVKNFPQAVESDRILDRPSQKEAEDAVRVLLRWAGDDPQREGLLDTPERVAKAYREL
FAGYDMSPEDVLGRTFEEVSGYDDMVLVRDIPFFSHCEHHMVPIIGKAHVAYLPNGRVLG
LSKIARTVEIFGRRLQTQEAMTAQIANAIDDSLRPRGVAVMIEAEHMCMAMRGVQKQGSS
TLTTTFTGAFKADPAEQVRFMTMVRSR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggacgccattgtaaagaactttccgcaagccgttgaatccgatcgtatattggaccgc
ccttcgcagaaggaagccgaagacgctgtccgcgttctgcttcgctgggcaggcgatgat
ccgcagcgcgaaggcctgctcgatacgccggaacgtgtcgccaaggcctatcgtgagctt
ttcgccggctatgatatgagcccggaggatgtgctaggtcgcaccttcgaggaggtttcc
ggctatgacgacatggtcctcgtgcgcgacattccatttttctcgcattgcgaacaccat
atggtgccgatcatcggcaaggcgcatgtcgcctatctgccgaatggccgcgtcctcggc
ctgtcgaagatcgctcgcaccgttgaaatcttcggccgccgcctgcagacgcaggaggcc
atgaccgcccagatcgccaacgccattgacgactcgctgcgtccgcgcggcgtcgccgtc
atgatcgaagccgagcatatgtgcatggcgatgcgcggtgtacagaagcaaggctcgtcg
acgttgacgacgactttcacgggcgccttcaaggccgatccggccgagcaggtccgcttc
atgacgatggtccggagccgttga

DBGET integrated database retrieval system