KEGG   Agrobacterium radiobacter: Arad_2476Help
Entry
Arad_2476         CDS       T00850                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00790  Folate biosynthesis
ara01100  Metabolic pathways
Module
ara_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Arad_2476 (folE)
Enzymes [BR:ara01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Arad_2476 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACM26658
UniProt: B9JFG8
Position
1:1960820..1961443
Genome map
AA seq 207 aa AA seqDB search
MDAIVKNFPQAVESDRILDRPSQKEAEDAVRVLLRWAGDDPQREGLLDTPERVAKAYREL
FAGYDMSPEDVLGRTFEEVSGYDDMVLVRDIPFFSHCEHHMVPIIGKAHVAYLPNGRVLG
LSKIARTVEIFGRRLQTQEAMTAQIANAIDDSLRPRGVAVMIEAEHMCMAMRGVQKQGSS
TLTTTFTGAFKADPAEQVRFMTMVRSR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggacgccattgtaaagaactttccgcaagccgttgaatccgatcgtatattggaccgc
ccttcgcagaaggaagccgaagacgctgtccgcgttctgcttcgctgggcaggcgatgat
ccgcagcgcgaaggcctgctcgatacgccggaacgtgtcgccaaggcctatcgtgagctt
ttcgccggctatgatatgagcccggaggatgtgctaggtcgcaccttcgaggaggtttcc
ggctatgacgacatggtcctcgtgcgcgacattccatttttctcgcattgcgaacaccat
atggtgccgatcatcggcaaggcgcatgtcgcctatctgccgaatggccgcgtcctcggc
ctgtcgaagatcgctcgcaccgttgaaatcttcggccgccgcctgcagacgcaggaggcc
atgaccgcccagatcgccaacgccattgacgactcgctgcgtccgcgcggcgtcgccgtc
atgatcgaagccgagcatatgtgcatggcgatgcgcggtgtacagaagcaaggctcgtcg
acgttgacgacgactttcacgggcgccttcaaggccgatccggccgagcaggtccgcttc
atgacgatggtccggagccgttga

DBGET integrated database retrieval system