KEGG   Agrobacterium radiobacter K84: Arad_2634Help
Entry
Arad_2634         CDS       T00850                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ara00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2079633..2080151)
Genome map
AA seq 172 aa AA seqDB search
MPEAGFSRATLGLGGNLDNPVRAMALALRTLDARDDCRVAAVSRVYRTPPWGKTDQSFFY
NSCAAIDTTLPPEALLDVCLNIEREMKRVRLERWGPRTIDIDVLTYGDIEQVEPLLTIPH
PRMTERGFVLMPLADFAADLLVKGRAVKDWLGAVDVQGIEIADENRDWWRSV
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgaagctggtttttcgcgcgccactctcggcctcggcggcaacctcgacaatccc
gtgcgggccatggcgcttgccttgcggacgctggacgcgcgcgatgattgccgtgttgcc
gcggtgtcgcgggtctatcgtacgccgccatggggtaagaccgatcaatccttcttctat
aattcctgcgccgctatcgatacgacgttgccgccggaagcactgctcgatgtctgcctg
aatatcgagcgcgagatgaagcgggtgcgcctggagcgctgggggccgcgcacgatcgac
atcgatgttctgacctatggcgatatcgagcaggtcgaaccactgctgacgatcccgcat
ccgcgcatgacagaacggggctttgtgctgatgccgcttgcggattttgccgccgacctc
ttggtcaagggacgagcggtgaaggattggctgggcgcagtggacgtgcaggggatcgag
atcgccgatgaaaaccgcgactggtggcgttcggtctga

DBGET integrated database retrieval system