KEGG   Agrobacterium radiobacter K84: Arad_2637Help
Entry
Arad_2637         CDS       T00850                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ara00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2080512..2081300)
Genome map
AA seq 262 aa AA seqDB search
MAIVNVTPDSFSDGGHYEAVDAAVAHALACVEEGADIIDIGGESTKPNADAVSATEEQGR
VLPVIEALRGKTDALISIDTYRADTARLAIGAGAHIVNDVFGLQREPEIAALAAQTGAGL
CIMHTGRDRQKLTDVIDDQVLFLSRSLDIAAAAGVDKQNIVLDPGFGFAKDTEENLELMA
RFTALLRFELPLLAGTSRKRFVGAVTGRDASDRDVGTAATSAILRLQGAAIFRVHNVAIN
RDALAVADAILRTRAKLGGRTP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgtcaacgtgacgccggattccttttccgacggcggccactatgaggctgtc
gatgcggcggtcgcccatgcgcttgcctgcgtcgaggagggtgctgatatcatcgatatc
ggtggggagtcgaccaagccgaacgcggacgccgtcagtgccacggaagagcaggggcgg
gtactgccggtcatcgaggcgctgcgtggcaagacggatgcgctgatctccatcgacacc
tatcgcgccgatacggcacggctggcgattggcgccggcgcccatatcgtcaacgacgtc
ttcggtctgcagcgtgagccggagatcgccgcattggcggcgcagacgggcgcggggctc
tgcatcatgcacaccggccgcgaccgacagaaacttactgatgttatcgacgaccaggtg
ctgtttttgagccgatcactcgatatcgccgctgcggctggtgtggacaagcagaatatc
gtactcgatcccggcttcggttttgccaaggataccgaggagaatctggagctgatggcg
cgcttcaccgcgctgctgcgcttcgaattgcccctgctggccggcacatcgcgcaagcgt
tttgtcggcgccgtcaccgggcgcgatgcgtccgatcgtgatgtggggacggcggcgacc
agcgccatattgcgtttgcagggcgccgcgatttttcgggtacacaatgtcgcaattaac
agggatgcactggcggtcgcggatgctatccttaggacacgggcgaaattaggcggcagg
acgccataa

DBGET integrated database retrieval system