KEGG   Agrobacterium radiobacter K84: Arad_2695Help
Entry
Arad_2695         CDS       T00850                                 

Definition
sensory box/GGDEF family protein
Orthology
K13590  
diguanylate cyclase
Organism
ara  Agrobacterium radiobacter K84
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2139214..2140281
Genome map
AA seq 355 aa AA seqDB search
MNTVIAPKAQVPDVAGQITYAMRSMGVAPIPRNYELFYEAYIGSNPVLTRELAALGSNAT
QEELDAISARHFARHSGRIFDEAHTRIITELDGVLRALQQEQTSLESYNRLLGETCQRIM
SKNHNSVDLLRGAIDILTEATGDTMAHGERTVENVNQRSQEMDQVRKELDEYKRIANTDA
LTRLSNRRAFDDRLAAVFDNQMARPVTALVLADIDHFKKINDNYGHPVGDKILATVASVI
RANVRREAFVARTGGEEFALILEGYTPDDALATCERIRRALEATPFKNSRTRVNYGPITI
SLGVCMASDATDPGELYGKADIALYSAKNAGRNCSYVYQNGMQKDFAKSWLIYKT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggtgattgcgcccaaggcgcaagttcccgacgtggcaggacagattacctat
gccatgcggtccatgggtgtcgcacccatcccgcggaattatgaactgttctacgaagcc
tatatcggctccaatcctgtcctgacccgcgaactcgccgccctcggcagcaacgccacg
caagaagagctggatgcgatcagcgcgcggcatttcgcccgccattccggtcgtattttc
gatgaggctcatacccgcatcattaccgaattggatggcgtgttgcgcgcgcttcagcaa
gagcagacctctctggaaagctacaaccggctgcttggcgaaacctgccagcgcatcatg
tccaagaatcacaacagcgtcgacttgctgcgcggtgctatcgacatcctgaccgaagcg
accggcgacaccatggcgcatggtgagcggaccgtcgagaacgtcaaccagcgcagccag
gaaatggaccaggtccgcaaggagctggacgaatacaagcgcatcgctaacaccgatgcg
ctgacacgcctctccaatcgccgcgccttcgacgaccgcctggctgccgttttcgacaac
cagatggccaggcccgtgacggcgctggtgctggcggacatcgatcatttcaagaaaatc
aacgacaactacggtcatccggtcggcgataagatcctagcaaccgtcgcctccgttatt
cgcgccaacgtccgccgagaggccttcgtcgcgcgtaccggcggcgaggagtttgcactg
atcctcgaaggctatacgccggatgacgcgctggcgacctgcgaacgcatccgtcgcgca
ctggaggcaacgccgttcaagaattcacgcaccagggtgaattatggcccgatcaccatc
tcactgggtgtctgcatggcctccgacgccacggatcctggcgaactctacggcaaggcg
gatatcgcgctctattccgccaaaaatgccggacgcaattgcagctacgtctatcagaac
ggcatgcagaaagacttcgcgaaaagttggcttatctacaagacataa

DBGET integrated database retrieval system