KEGG   Agrobacterium radiobacter: Arad_2695Help
Entry
Arad_2695         CDS       T00850                                 

Definition
(GenBank) sensory box/GGDEF family protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ara  Agrobacterium radiobacter
Brite
Enzymes [BR:ara01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Arad_2695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:2139214..2140281
Genome map
AA seq 355 aa AA seqDB search
MNTVIAPKAQVPDVAGQITYAMRSMGVAPIPRNYELFYEAYIGSNPVLTRELAALGSNAT
QEELDAISARHFARHSGRIFDEAHTRIITELDGVLRALQQEQTSLESYNRLLGETCQRIM
SKNHNSVDLLRGAIDILTEATGDTMAHGERTVENVNQRSQEMDQVRKELDEYKRIANTDA
LTRLSNRRAFDDRLAAVFDNQMARPVTALVLADIDHFKKINDNYGHPVGDKILATVASVI
RANVRREAFVARTGGEEFALILEGYTPDDALATCERIRRALEATPFKNSRTRVNYGPITI
SLGVCMASDATDPGELYGKADIALYSAKNAGRNCSYVYQNGMQKDFAKSWLIYKT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggtgattgcgcccaaggcgcaagttcccgacgtggcaggacagattacctat
gccatgcggtccatgggtgtcgcacccatcccgcggaattatgaactgttctacgaagcc
tatatcggctccaatcctgtcctgacccgcgaactcgccgccctcggcagcaacgccacg
caagaagagctggatgcgatcagcgcgcggcatttcgcccgccattccggtcgtattttc
gatgaggctcatacccgcatcattaccgaattggatggcgtgttgcgcgcgcttcagcaa
gagcagacctctctggaaagctacaaccggctgcttggcgaaacctgccagcgcatcatg
tccaagaatcacaacagcgtcgacttgctgcgcggtgctatcgacatcctgaccgaagcg
accggcgacaccatggcgcatggtgagcggaccgtcgagaacgtcaaccagcgcagccag
gaaatggaccaggtccgcaaggagctggacgaatacaagcgcatcgctaacaccgatgcg
ctgacacgcctctccaatcgccgcgccttcgacgaccgcctggctgccgttttcgacaac
cagatggccaggcccgtgacggcgctggtgctggcggacatcgatcatttcaagaaaatc
aacgacaactacggtcatccggtcggcgataagatcctagcaaccgtcgcctccgttatt
cgcgccaacgtccgccgagaggccttcgtcgcgcgtaccggcggcgaggagtttgcactg
atcctcgaaggctatacgccggatgacgcgctggcgacctgcgaacgcatccgtcgcgca
ctggaggcaacgccgttcaagaattcacgcaccagggtgaattatggcccgatcaccatc
tcactgggtgtctgcatggcctccgacgccacggatcctggcgaactctacggcaaggcg
gatatcgcgctctattccgccaaaaatgccggacgcaattgcagctacgtctatcagaac
ggcatgcagaaagacttcgcgaaaagttggcttatctacaagacataa

DBGET integrated database retrieval system