KEGG   Agrobacterium radiobacter: Arad_2774Help
Entry
Arad_2774         CDS       T00850                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ara  Agrobacterium radiobacter
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Arad_2774
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arad_2774
  Lipid metabolism
   00071 Fatty acid degradation
    Arad_2774
  Amino acid metabolism
   00350 Tyrosine metabolism
    Arad_2774
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Arad_2774
   00626 Naphthalene degradation
    Arad_2774
Enzymes [BR:ara01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Arad_2774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2200218..2201246)
Genome map
AA seq 342 aa AA seqDB search
MRALQLIDDRKLETTDLPEPEAPGAGEVTLRVKAVALNHIDVWGWRGMAFAKRKMPLVIG
AEASGVVEAIGPGVANVLPGQLVSIYGARTCGLCRHCREGRDNLCEHVGGVHGFHLDGFA
QEKVNLPARLLVPAPPGVDAIGAALAPVTFGTVEHMLFDNAKLEPGETILVHAGGSGIGT
AAIQLAKKIGCTVITTVGSDDKIEKAKALGADHVINYRTDRFEGVVRKLTKKKGVDVVFE
HVGKDTWAGSMLCMKRGGRLVTCGSTSGVSTEMNLMMLFQQQLKLLGSFGCRMENMANAM
QKMARGLVHPVIDTEVSFSDIDRALERMESRQIFGKIILKMD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctttgcaactgatcgacgaccgcaaacttgagaccaccgatctgccggagcca
gaggctccaggcgcgggcgaggtgaccctgcgtgtcaaggcggtcgccctcaatcatatc
gacgtctggggctggcgcggcatggcctttgccaagcgcaagatgccgctggtgatcggc
gcggaagcgtccggtgtcgtcgaagcgatcgggccgggcgttgccaatgtgctgccgggc
cagcttgtgtcgatctatggcgcgcgcacctgcggcctctgccgtcattgccgcgagggt
cgcgacaatctctgcgaacatgttggcggcgtgcatggcttccatcttgacggcttcgcc
caggaaaaggtcaatctgccggcgcgcctgctggttccggctcctcccggtgttgatgcg
atcggcgcggcgctggcgcccgtcaccttcggcacggtcgagcacatgctgttcgacaat
gccaagctggagccgggcgagacgatcctcgttcatgccggcggctctggcatcggcacg
gcggcgatccagcttgccaagaagatcggctgcaccgtcatcaccaccgttgggtccgac
gacaagatcgagaaggccaaggcgctgggcgccgatcacgtcatcaactaccgcaccgac
cgttttgagggcgtggtgcgcaagctgaccaagaagaagggcgtcgacgtcgtcttcgaa
catgtcggcaaggatacctgggccggctccatgctgtgcatgaagcgcggcggtcgtctt
gtcacctgcggctcgacctcgggtgtctccaccgagatgaacctgatgatgctcttccag
cagcagctgaaactgctcggctccttcggttgccgcatggagaacatggcgaatgccatg
cagaagatggcgcgcggactggtgcatccggtgatcgacactgaagtgagcttcagcgat
atcgaccgggcgctggagcggatggaatcgcgccagatcttcggcaagatcatcctcaag
atggattga

DBGET integrated database retrieval system