KEGG   Agrobacterium radiobacter K84: Arad_3311Help
Entry
Arad_3311         CDS       T00850                                 

Gene name
bdhA
Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ara00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:ara00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2642957..2643733
Genome map
AA seq 258 aa AA seqDB search
MARTVVVTGSTSGIGLAIATAFAAKGENIVINGFGKPEEIDAIRNTLEASGGGKVIYHPA
DMTKPAEIADLIATANSTFGSVDVLVNNAGIQHVEKIEDFPIDKWDQIIAINLSSSFHTI
RAAVPLMKANKYGRIINIASAHALVASPFKSAYVAAKHGILGLTKTVALELAEFGVTANA
ICPGYVLTPLVEKQIPDTAKARGMTEEQVKNEVILKAQPTHEFVKAEEIGALSLYLASDD
ARQITGTHVSIDGGWTAE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaacagtcgttgtcaccggttctacaagcggtatcggcctcgccatcgcgacc
gccttcgccgcgaagggtgaaaacatcgtcatcaatggtttcggcaagccggaagagatc
gatgccatcagaaacacgcttgaagcctcgggcggcggcaaagtgatctaccatccggcc
gacatgaccaagcccgccgagattgccgacctgatcgcgaccgccaattcgaccttcggc
agcgtcgacgttctggtcaacaatgccggcatccagcatgtcgagaagatcgaggatttc
ccgatcgacaaatgggaccagatcatcgccatcaatctgtcgagctcgttccacaccatt
cgcgcggccgtgccgctgatgaaggcgaacaaatacggccgcatcatcaatatcgcatcg
gcccacgccctcgtcgcctccccgttcaaatccgcctatgtcgcggcaaagcatggtata
ttgggcctgaccaagacggttgcgctcgagcttgccgaattcggcgtcacggccaacgcc
atttgccccggctatgttctgaccccgctcgtcgaaaagcagatcccggacacggccaag
gcgcgagggatgaccgaggagcaggtcaagaacgaggtgatcctcaaggcgcagccgacg
catgaattcgtcaaggccgaggagatcggcgcattgtcgctctacctagccagcgacgac
gcgcgtcagatcaccggcacacacgtctcgattgacggtggctggactgcggaataa

DBGET integrated database retrieval system