KEGG   Agrobacterium radiobacter: Arad_3497Help
Entry
Arad_3497         CDS       T00850                                 

Gene name
pssB
Definition
exopolysaccharide production protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ara  Agrobacterium radiobacter
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Arad_3497 (pssB)
Enzymes [BR:ara01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Arad_3497 (pssB)
Transfer RNA biogenesis [BR:ara03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Arad_3497 (pssB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2796973..2797767
Genome map
AA seq 264 aa AA seqDB search
MLATFEKAALEAGKAILEVYRAGYAVALKQDQSPVTLADERAEHIILDYLTRDFPDIPAI
AEESVAAGRIPDIRGRSFFLVDPLDGTREFIEHRDEFTVNIAYIHNGAPVAGIVFAPALG
IAFTGEGGEARKLVISDNFTVSDRSIIAVRGRPDRLLALASRCNSSPRTDSFLAENAVSA
CTSIGSSLKFCLLAEGKADVYPRFTRTMEWDTAAGDAVLRAAGGSTVTLDGHPLAYGKTD
QSEDSDFANPNFICWGGKKNLVDA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcgacatttgaaaaagcagccctagaggcgggtaaggccattttggaggtctac
cgcgcgggctatgctgtcgccttgaagcaggatcagagccccgtcaccctcgccgacgaa
cgcgccgaacatatcatcctcgattacctgacgcgcgatttccccgacattccggcaatt
gccgaggaatcggtggccgccggcaggattcccgacattcgcggccgctccttcttcctc
gtcgatccgctcgacggcacgcgcgaattcatcgagcatcgcgacgaattcaccgtcaac
atcgcctatatccacaacggcgctcccgtcgccgggatcgttttcgcgccggcactcggc
attgcctttaccggcgaaggcggcgaggcgcgcaagctcgtcatttcggacaatttcacc
gtctccgaccgttcgatcattgccgtgcgcgggcgacccgacaggctgctggcgcttgcc
agccgctgcaacagcagcccgaggacagacagcttcctggcggaaaacgccgtctccgcc
tgcacgtcgatcggttcttcgctgaagttctgtcttctcgccgaaggcaaggccgacgtc
tatccgcgctttacccgcacgatggagtgggacactgcggccggcgatgccgtattgcgc
gctgcaggcggctcgactgtcacgctcgacggccatcccctcgcctacggcaagaccgac
cagagcgaagattccgatttcgccaatcccaattttatctgctggggcggaaagaaaaat
ctcgtcgacgcctag

DBGET integrated database retrieval system