KEGG   Agrobacterium radiobacter: Arad_3851Help
Entry
Arad_3851         CDS       T00850                                 

Gene name
pldB
Definition
lysophospholipase L2 protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ara  Agrobacterium radiobacter
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Arad_3851 (pldB)
Enzymes [BR:ara01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Arad_3851 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3064023..3064997
Genome map
AA seq 324 aa AA seqDB search
MDSILYSTPDNPVPENRIEGFFESFDGRKLRYAVFRSEQPVAKGTVVLLQGRNEFIEKYL
ETIRDLTAKGLWVATFDLRSQGGSERLLKDPRRGHVHRFSDYERDLTAFLDKIVLPDTRL
PFFLLAHSTGALIALSAAPRLASRIERMVLLAPFVGLMGQGASPGLVRAISGAASAIGLG
RIQFSKKNLERPFSENPLTGDERRYRRNTGIAATYPQLVLGPPTARWLSEAFRAIDHVTR
PEHLFSISIPTVLIAPTRDGIVPYADQERLARYFRAAQLVPIYGSKHEILQERDIYRNAA
LAAINAFIPGSDAEANAEAMDVGS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggattcgatcctctattccacgccagacaatccggtgccggaaaaccgcatcgagggg
ttcttcgaaagcttcgacgggcgcaagctgcgctatgccgtcttccgcagcgagcagcct
gtcgccaagggaaccgtggtgctgctgcagggccgcaacgagttcatcgagaaatatctg
gagacaatccgcgatctcaccgccaaggggctgtgggtcgcgaccttcgatctgcgtagc
cagggtggatccgagcggctgctgaaggatccgaggcgcgggcatgtccaccgtttttcc
gattacgaacgcgatctcaccgccttcctcgacaagatcgtactgccggacacgcgcctg
cccttcttcctgctcgcgcattcgaccggcgcactgatcgcgctgtcggcggcaccccgg
ctggcgagccggatcgagcgcatggtgctgctcgcacccttcgtcggcctcatgggccag
ggagcttcgcccggtctcgtgcgcgccatctcaggtgcagccagcgccatcggtcttggc
cggattcaattcagcaagaaaaatctggaaagaccgttctccgaaaacccgctgaccggc
gacgagcggcgctaccggcgcaacacgggaatcgccgccacctatccgcagctcgtgctc
gggccgccgacggcgcgctggctgtcggaagcttttcgtgccatcgaccatgtcaccaga
cccgaacatctattctcgatcagcattccgaccgtactgatcgcgccgacccgcgatggc
atcgtgccctatgccgaccaggagcggctggcgcgctacttccgcgcggcgcaactcgtg
cccatttacggatccaaacatgaaatcctgcaggagcgggatatctaccgaaacgcggcg
ctagcggccatcaatgctttcattcccggcagcgacgccgaagcgaatgccgaggcaatg
gacgtcggaagctag

DBGET integrated database retrieval system