KEGG   Agrobacterium radiobacter: Arad_3909Help
Entry
Arad_3909         CDS       T00850                                 

Definition
methylamine utilization protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ara  Agrobacterium radiobacter
Brite
Enzymes [BR:ara01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Arad_3909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3120791..3122176
Genome map
AA seq 461 aa AA seqDB search
MSLKSNHRLLPLIALAGVSLAGATIGMANQPAPDASPATNTYEDTVPLSAVAQLGKKLFY
DPSLSGSGQMSCSTCHDPNNHYAPANGLSVQLGGVHLDQPGIRTVPSLAYKMSTPSFSIG
EESAADEAAEAAPMTEASGVALANTPAVVAGPLTAQAVVKADAAAANLVPQGGMFWDGRV
DSLEEQALQPMISPFEMANADAATVYAKLKKGYGKDIAALFGNNVLNDQDMAISEVGFAL
ARYQIEEPSFHPYTSKYDYFLRGKAALSDAEQRGLKLFDDANKGNCASCHLDKMMGDGQM
PNFTDFEFEALGAPRNPDIPANADPHYYDIGICGPLRYDTYSAQPQNCGLFKTPTLRNVA
SRRFFFHNGVYRSLEDVTRFYVRRDTNPEEIYPKDTNGHVQKFNDLPQQYQANIDIIDAP
MNRKQGDVAALNDAEIADVVAFLKTLTDGYDPAKDGVKAAK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgaaatccaatcaccgtctcctgcccctcatcgcactcgcgggcgtgtcgctc
gcgggggcgaccatcggcatggcaaaccagcctgcccccgatgcctccccggccacgaat
acctatgaggataccgtgccgctgagcgccgttgcccagctcggcaagaagctgttctac
gacccctccctatccggcagcggccagatgtcctgttccacctgccatgatccaaacaat
cactatgcgccggccaatggcctctccgtacagcttggcggcgtgcatctcgaccagccg
ggcatccgcaccgtgccgagcctcgcctacaagatgtcgaccccttccttctcgatcgga
gaagaaagcgctgccgacgaggcggcggaggcagcaccgatgaccgaggcctctggtgtt
gccctcgccaatacgccggcggtcgttgccgggccactgaccgcgcaagccgtcgtcaag
gccgatgcagccgccgcgaacctggtgccgcaaggcggcatgttctgggacggacgtgtc
gattcgctggaggagcaggccttgcagccgatgatttcgcccttcgaaatggccaatgcg
gatgcggcgactgtctatgcgaagctgaaaaagggctatggcaaggatatcgccgccctc
ttcggcaacaacgtcctcaacgatcaggacatggcgatctccgaagtcggcttcgcgctc
gcccgctaccagatcgaagagccctctttccatccttatacgagcaaatacgactatttt
ctgcgcggcaaggcggcgctctcggatgccgagcagcgtgggctgaaactgttcgacgac
gctaacaagggcaattgcgcctcctgccatctcgataagatgatgggcgacgggcagatg
ccgaacttcaccgatttcgagttcgaagccttgggcgcgccgcgcaatccggacatcccg
gccaatgccgatccgcattactacgacatcggcatctgcggcccgctgcgctacgacacc
tattccgcccagccgcagaattgcgggctgttcaagacgccgacgctgcgcaatgtcgcc
agccgccgtttcttcttccacaatggcgtctatcgctcgctggaggatgtcactcggttt
tatgtcaggcgcgacaccaatccggaggagatctatccgaaggataccaacgggcatgta
cagaaattcaatgatttaccgcagcaatatcaggccaatatcgacatcatcgacgcgccg
atgaaccgcaaacaaggcgatgtagcggctctgaacgacgccgaaattgccgacgtcgtg
gcgtttctgaagacgctgacggatggatatgacccggcaaaggatggggtgaaggcggca
aaatga

DBGET integrated database retrieval system