KEGG   Agrobacterium radiobacter K84: Arad_3938Help
Entry
Arad_3938         CDS       T00850                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ara00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ara00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3144901..3146211)
Genome map
AA seq 436 aa AA seqDB search
MSTGFFGDIAKVKYEGPDSTNPLAFRHYNKDEVVLGKRMEDHLRFAVAYWHTFTWPGGDP
FGGQTFLRPWFNETMEAAKLKADVAFEFFTLLGSPYYCFHDADVRPEGKNFAENTKNLNE
IVDYFAQKQADTGVKLLWGTANLFSNRRFMSGAATNPDPDVFAFSAATVKTCMDATHKLG
GENYVLWGGREGYETLLNTDLKRELDQMGRFLNLVVEYKHKIGFKGAILIEPKPQEPTKH
QYDYDVATVYGFLKKNGLENEVKLNIEQGHAILAGHSFEHELALANALGIFGSIDMNRND
YQSGWDTDQFPNNVPEMSLAYYQVLAGGGFKSGGTNFDSKLRRQSLDPADLLIGHIGGMD
CCARGLKAAAKMIEDKALSQPLADRYAGWDSAEGQKLLRGEYSLDQIAQWVEAKDINPQP
KSGKQELLENIVNRYV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccggctttttcggcgatatcgccaaggttaaatatgaaggccccgacagcacc
aatccgctggccttccgccactacaacaaggacgaagtggttctcggcaagcgcatggaa
gaccatctgcgctttgccgttgcctattggcacaccttcacctggccgggcggcgacccc
ttcggcggacagaccttcctgcgtccttggttcaacgagacgatggaagctgccaagctg
aaggctgacgttgccttcgaattcttcactttgcttggttcgccctattattgcttccac
gatgccgacgtgcgtccggaaggcaagaatttcgccgagaacaccaagaacctaaacgag
attgtcgattacttcgcgcagaagcaggccgataccggcgtcaagcttttgtggggcacg
gcaaacctcttctccaaccgccgcttcatgtcgggcgctgccaccaatccggatccggat
gtcttcgctttctcggctgcgaccgtgaagacctgcatggatgcgacgcacaagctcggc
ggcgaaaactacgttctctggggcggccgcgaaggctatgaaaccctgctcaacaccgac
ctgaagcgcgagctggaccagatgggccgcttcctcaacctcgtggtcgaatacaagcac
aagatcggcttcaagggcgcgatcctgatcgagccgaagccgcaggagccgaccaagcat
cagtacgattacgacgtcgcgaccgtctatggcttcctgaagaagaacggcctcgaaaac
gaagtgaagctcaacatcgagcagggccacgcgatcctcgccggccattctttcgaacat
gaactggcgcttgccaacgcgctcggcatcttcggctcgatcgacatgaaccgcaacgac
taccagtccggctgggataccgaccagttcccgaacaatgttccggaaatgtcgctggcc
tactatcaggttctggcaggcggcggcttcaagagcggcggcaccaacttcgactcgaag
ctgcgccgtcagtcgctcgatccggcagacctgctgatcggccatatcggtggtatggat
tgctgcgctcgtggcctgaaggctgcggccaagatgatcgaggacaaggccctttcgcag
ccgctcgccgaccgttacgccggctgggattcggctgaaggccagaagctgctccgcggc
gagtactcgctcgaccagatcgcacagtgggtcgaggccaaggatatcaatccgcagccg
aagtccggcaagcaggaactgctggaaaacatcgtcaaccgttacgtttga

DBGET integrated database retrieval system