KEGG   Agrobacterium radiobacter: Arad_4346Help
Entry
Arad_4346         CDS       T00850                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ara  Agrobacterium radiobacter
Pathway
ara00020  Citrate cycle (TCA cycle)
ara00190  Oxidative phosphorylation
ara00650  Butanoate metabolism
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01120  Microbial metabolism in diverse environments
ara01130  Biosynthesis of antibiotics
ara01200  Carbon metabolism
Module
ara_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ara_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ara_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Arad_4346 (sdhD)
   00650 Butanoate metabolism
    Arad_4346 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Arad_4346 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Pox_F16
Motif
Other DBs
NCBI-ProteinID: ACM28072
UniProt: B9JCG1
Position
1:complement(3476879..3477259)
Genome map
AA seq 126 aa AA seqDB search
MDMRTPLGKVRGLGSAKEGTDHFWRQRLTAVANVPLFIFFVIFLIIYAGAPYAEVVHALS
NPFVAVIMGLMVISGIIHMKLGMQVIIEDYVHGEFGKIVLLMLNTFFSIVMAGLCLFAIL
KIAFVG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcgtacccctttgggcaaagtccgcggcctcggctccgccaaggaaggcacc
gaccatttctggcgccagcgcctgaccgccgtcgccaacgtcccgctcttcattttcttc
gtcattttcctgatcatctatgctggcgctccctatgcggaggtcgtgcacgccctgtcg
aatcccttcgtcgccgtcatcatgggtctgatggtgatctccggcatcattcacatgaag
ctcggcatgcaggtcatcatcgaggactatgtccacggcgaattcggcaagatcgtcctt
ctcatgctcaacacattcttctcgatcgtcatggcggggctctgtctcttcgccattctg
aagatcgcgttcgtaggataa

DBGET integrated database retrieval system