KEGG   Agrobacterium radiobacter: Arad_4357Help
Entry
Arad_4357         CDS       T00850                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ara  Agrobacterium radiobacter
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Arad_4357 (hemD)
Enzymes [BR:ara01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Arad_4357 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3482988..3483713
Genome map
AA seq 241 aa AA seqDB search
MRVVVTRPQHSGERTVRRLTEMGHEPLPLPLSEPVHDVDAARQALSETQGAIAVTSAEAI
RTLAALGQNIAPHLGRPLFAVGKATAKEARILGFTHVLTSEGSGIELAELIAHNRAGMQQ
TLLYLAGSPRAAGFETRSTELNIPLRTVECYHMLDITPDDATLRKFFIDTPADAVLFYSR
QTALRFFSLPFLRQQPDALAPTRFLCLSEAIADAVPALLRAQSDIAAMPDEDSLLALLTT
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgtcgtcacccgcccccagcattcgggtgaacgcaccgtccggcggctgacg
gagatgggacacgagccgctgccgctgccgctgtcggagccggtgcacgatgtcgatgca
gcccgacaggcgctgtcggaaacgcaaggcgctattgccgtcaccagcgccgaggcgatc
cgcaccctagccgcactgggccaaaatatcgcgcctcatcttggtcgcccgctctttgcc
gtcggcaaggcgacggcaaaggaagcaaggatccttggctttacccatgttcttacctcc
gaaggcagcggcatcgaactcgcggagctgattgcccacaaccgagccggcatgcaacag
accttgctctatctcgccggctcgccgcgcgccgccggttttgaaacaagatcgacggaa
ttgaatatcccgctgcggacggtggaatgctaccacatgctggatatcacccccgacgat
gcgaccctccgcaagttttttatcgacacccctgccgacgccgtactgttctattcccgc
cagacggcactgcgctttttcagcctgcccttcctgcggcaacagccggatgcccttgcc
ccaacgaggttcctctgcctcagtgaagcgattgcggatgctgtcccggccttgctgcgc
gcccaatcggatattgccgccatgccggatgaagacagtcttctggcgcttctgacgacg
gagtaa

DBGET integrated database retrieval system