KEGG   Agrobacterium radiobacter: Arad_4562Help
Entry
Arad_4562         CDS       T00850                                 

Gene name
hutU
Definition
urocanate hydratase
Orthology
K01712  
urocanate hydratase [EC:4.2.1.49]
Organism
ara  Agrobacterium radiobacter
Pathway
Histidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Arad_4562 (hutU)
Enzymes [BR:ara01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.49  urocanate hydratase
     Arad_4562 (hutU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3655360..3657045)
Genome map
AA seq 561 aa AA seqDB search
MTNPRHNIREIRSPRGPELNAKSWMTEAPLRMLMNNLDPDVAENPNELVVYGGIGRAART
WEDFDRIAATLKTLTEEETLLVQSGKPVGVFRTHKDAPRVLIANSNLVPHWATWDHFNEL
DKKGLAMYGQMTAGSWIYIGTQGIVQGTYETFVEAGRQHYNGSLKGKWILTGGLGGMGGA
QPLAAVMAGACCLAVESDETRIDFRLRTRYVDEKATSLDEALAMIDKWTKAGEAKSVGLL
GNAAEIFPELVKRMKAGGPRPDIVTDQTSAHDPLNGYLPLGWTVAEHKIKRESDPKAVEA
AARASMKMHVEAMVAFWDAGVPTLDYGNNIRQVAKEEGFENAFAFPGFVPAYIRPLFCRG
IGPFRWAALSGDPEDIYKTDAKVKELTPGNTHLHNWLDMARERIAFQGLPARICWVGLGD
RERLGLAFNEMVKNGELKAPVVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALL
NTASGATWVSLHHGGGVGMGFSQHSGMVICADGTDDAARRIERVLWNDPATGVMRHADAG
YDIALDCAKDKGLRLPGILGN
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacccacgccataacatccgcgaaatccgctcccctcgcggtccggagctcaac
gccaagagctggatgaccgaagcgccgctgcggatgctgatgaacaatctcgatcccgac
gttgcggaaaatccaaacgagctggtcgtctatggcggcatcggccgcgctgcccgcacc
tgggaggatttcgaccgcatcgccgcgacgctgaagaccttgaccgaggaagagacgctg
ctggtgcagtccggcaagccggtcggcgtgttccgtacccacaaggacgcgccgcgcgtg
ctcatcgccaattccaacctcgtgccgcattgggcgacctgggatcacttcaacgagctg
gataagaagggtctcgccatgtacggccagatgaccgccggctcgtggatctatatcggc
acgcagggcatcgttcagggcacctatgagaccttcgtcgaggctggtcgtcagcactat
aacggcagcctcaagggcaagtggatcctgaccggcggcctcggcggcatgggtggcgca
cagccgctggcagccgtcatggccggcgcctgctgccttgcggtcgaaagtgatgagacc
cgcatcgatttccgcttgcgcacccgctatgtcgacgagaaggcaacgagcctcgatgaa
gcgcttgcgatgatcgacaaatggaccaaggccggcgaagccaaatcggtcggcctgctc
ggcaacgccgccgaaatcttcccggaactggtgaagcgcatgaaggctggcggcccgcgc
cccgacatcgtcaccgaccagacctcggcacatgatccgctgaacggttatctgccgctc
ggctggaccgtcgccgaacacaagatcaagcgcgagagcgatccgaaggccgtcgaagct
gccgctcgtgcgtcgatgaagatgcatgtcgaggccatggtcgccttctgggatgccggc
gtgccgacgctcgactatggcaacaatatccgccaggtcgccaaggaagaaggctttgaa
aacgcctttgccttccctggcttcgtgccggcctatattcgcccgctgttctgccgcggc
atcggccccttccgctgggctgccctctcgggcgatcccgaggatatctacaagaccgac
gccaaggtgaaggaacttacccccggcaacacccatctgcacaactggctggacatggcg
cgcgagcgcatcgccttccagggcttgccggcgcgcatttgctgggtcggcctcggtgat
cgtgaacgcctcggccttgccttcaacgaaatggtcaagaatggcgagctgaaggctcct
gtcgtcatcggccgcgatcatctcgattccggctccgtcgcctcgccgaaccgcgagacg
gaagcgatgaaggacggctcggacgccgtttccgactggccactgctgaacgccctgctc
aacactgcatctggcgccacctgggtgtcgctgcatcacggcggcggcgtcggcatgggc
ttttcccagcattccggcatggtcatttgtgccgatggcaccgacgatgcagcccgccgc
atcgaacgcgtgctgtggaacgacccggcgacgggcgtcatgcgccacgccgatgcgggc
tacgacatcgcgcttgattgcgccaaggacaagggcctgcggttgccgggcatcctgggg
aactga

DBGET integrated database retrieval system