KEGG   Agrobacterium radiobacter K84: Arad_4562Help
Entry
Arad_4562         CDS       T00850                                 

Gene name
hutU
Definition
urocanate hydratase
Orthology
K01712  
urocanate hydratase [EC:4.2.1.49]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Histidine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ara00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3655360..3657045)
Genome map
AA seq 561 aa AA seqDB search
MTNPRHNIREIRSPRGPELNAKSWMTEAPLRMLMNNLDPDVAENPNELVVYGGIGRAART
WEDFDRIAATLKTLTEEETLLVQSGKPVGVFRTHKDAPRVLIANSNLVPHWATWDHFNEL
DKKGLAMYGQMTAGSWIYIGTQGIVQGTYETFVEAGRQHYNGSLKGKWILTGGLGGMGGA
QPLAAVMAGACCLAVESDETRIDFRLRTRYVDEKATSLDEALAMIDKWTKAGEAKSVGLL
GNAAEIFPELVKRMKAGGPRPDIVTDQTSAHDPLNGYLPLGWTVAEHKIKRESDPKAVEA
AARASMKMHVEAMVAFWDAGVPTLDYGNNIRQVAKEEGFENAFAFPGFVPAYIRPLFCRG
IGPFRWAALSGDPEDIYKTDAKVKELTPGNTHLHNWLDMARERIAFQGLPARICWVGLGD
RERLGLAFNEMVKNGELKAPVVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALL
NTASGATWVSLHHGGGVGMGFSQHSGMVICADGTDDAARRIERVLWNDPATGVMRHADAG
YDIALDCAKDKGLRLPGILGN
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacccacgccataacatccgcgaaatccgctcccctcgcggtccggagctcaac
gccaagagctggatgaccgaagcgccgctgcggatgctgatgaacaatctcgatcccgac
gttgcggaaaatccaaacgagctggtcgtctatggcggcatcggccgcgctgcccgcacc
tgggaggatttcgaccgcatcgccgcgacgctgaagaccttgaccgaggaagagacgctg
ctggtgcagtccggcaagccggtcggcgtgttccgtacccacaaggacgcgccgcgcgtg
ctcatcgccaattccaacctcgtgccgcattgggcgacctgggatcacttcaacgagctg
gataagaagggtctcgccatgtacggccagatgaccgccggctcgtggatctatatcggc
acgcagggcatcgttcagggcacctatgagaccttcgtcgaggctggtcgtcagcactat
aacggcagcctcaagggcaagtggatcctgaccggcggcctcggcggcatgggtggcgca
cagccgctggcagccgtcatggccggcgcctgctgccttgcggtcgaaagtgatgagacc
cgcatcgatttccgcttgcgcacccgctatgtcgacgagaaggcaacgagcctcgatgaa
gcgcttgcgatgatcgacaaatggaccaaggccggcgaagccaaatcggtcggcctgctc
ggcaacgccgccgaaatcttcccggaactggtgaagcgcatgaaggctggcggcccgcgc
cccgacatcgtcaccgaccagacctcggcacatgatccgctgaacggttatctgccgctc
ggctggaccgtcgccgaacacaagatcaagcgcgagagcgatccgaaggccgtcgaagct
gccgctcgtgcgtcgatgaagatgcatgtcgaggccatggtcgccttctgggatgccggc
gtgccgacgctcgactatggcaacaatatccgccaggtcgccaaggaagaaggctttgaa
aacgcctttgccttccctggcttcgtgccggcctatattcgcccgctgttctgccgcggc
atcggccccttccgctgggctgccctctcgggcgatcccgaggatatctacaagaccgac
gccaaggtgaaggaacttacccccggcaacacccatctgcacaactggctggacatggcg
cgcgagcgcatcgccttccagggcttgccggcgcgcatttgctgggtcggcctcggtgat
cgtgaacgcctcggccttgccttcaacgaaatggtcaagaatggcgagctgaaggctcct
gtcgtcatcggccgcgatcatctcgattccggctccgtcgcctcgccgaaccgcgagacg
gaagcgatgaaggacggctcggacgccgtttccgactggccactgctgaacgccctgctc
aacactgcatctggcgccacctgggtgtcgctgcatcacggcggcggcgtcggcatgggc
ttttcccagcattccggcatggtcatttgtgccgatggcaccgacgatgcagcccgccgc
atcgaacgcgtgctgtggaacgacccggcgacgggcgtcatgcgccacgccgatgcgggc
tacgacatcgcgcttgattgcgccaaggacaagggcctgcggttgccgggcatcctgggg
aactga

DBGET integrated database retrieval system