KEGG   Agrobacterium radiobacter K84: Arad_4648Help
Entry
Arad_4648         CDS       T00850                                 

Gene name
galM
Definition
aldose epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ara00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ara00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3733498..3734523
Genome map
AA seq 341 aa AA seqDB search
MTENSLQREVFGTTPTGETVYRAKIVGGGLTAHIISWGAVIQDLRLDGHGPALLLGFDNF
ADYPAHSSYFGATPGRCANRIGAGRFTLDGKDYQLELNEKGVTHLHGGKDNIAKRNWTIV
EHAVDRVVLKIVDPDGRAGYPGNCTIQATYRVHGNGELSVTYESTSDQPTLANVCQHAYF
NLDGRDDALGHDIMIAADHYTPTDEKQVPTGEVRSVEGTVFDFREMASMKRFDGAEQALY
DHNFCLSPERTAKRSVVLARSVNSGVSLEVRTTEPGVQFYAGFKLDVPVPGHDGQKIGPF
AGFCLETQVWPDAINHEGFPNAVLRPGEVLRQETDYIFTKN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaacagtttgcaacgggaagttttcggaacgacgccaaccggtgaaacagtc
tatcgcgccaagatcgtcggcggtgggcttacggcgcatatcatcagctggggcgccgtc
attcaggacctgcggctcgacggccacggcccggccttgctgctcggcttcgacaatttc
gccgattatccggcccattcgtcctatttcggcgccacgcccggccgctgcgccaaccgc
atcggcgccggccgcttcacgcttgatggcaaggactaccagctcgagctcaacgagaag
ggcgtcacccacctgcacggcggcaaggacaatatcgccaagcgcaactggacgatcgtc
gagcatgcggtcgatcgcgtcgtgctgaagatcgtcgatcccgatggccgcgccggctat
cccggcaattgcacgatccaggcgacctatcgggtgcatggcaatggcgaattgtccgtt
acctatgaatcgaccagcgaccaaccgacactcgccaatgtctgccagcacgcctatttc
aacctcgacggccgcgacgacgcgctcggccacgacatcatgatcgccgccgatcactat
accccgacggacgaaaagcaggtgccgacgggcgaagtgcgctcggtcgaaggcaccgtc
ttcgacttccgcgaaatggcgtcgatgaagcgctttgacggcgccgaacaggcgctctac
gaccataatttctgcctgtcgccggaacgcaccgccaagcgctccgtggtgctggcgcgc
agcgtcaattccggcgtctcgctggaagtgcgtaccaccgagcccggcgtgcagttctat
gccggcttcaagctcgatgttcccgttcccggccatgacggtcagaagatcggccccttc
gctggcttctgcctcgaaacccaggtctggcccgacgccatcaaccatgaaggcttcccg
aatgccgtgcttcgccccggcgaagtgctgcggcaggaaaccgattatatcttcacgaaa
aactga

DBGET integrated database retrieval system