KEGG   Agrobacterium radiobacter K84: Arad_4836Help
Entry
Arad_4836         CDS       T00850                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:ara00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ara00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3911616..3912167)
Genome map
AA seq 183 aa AA seqDB search
MNFKAIPQAIPDVLLLEHREFGDDRGSFTETFRDSAFQELGFPQFVQDNQSRSSKGVVRG
LHYQVNPNAVGKLVRCVHGRIFDVAVDLRLGSPTYGKWTGTELAGTDNHMFYVPEGFAHG
FMALEDDTLVSYRQTGYWDAASERSLLWNDPDVAIDWPKLAVLLSPKDANATRFADVDHN
FRY
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaaggctattccacaggctatccccgacgtcctgctcttggaacacagggaa
ttcggagacgatcgcggctcgtttaccgagacgtttcgcgactccgcgtttcaggaactt
gggttcccgcaatttgtacaggacaatcaatcacgctcttcaaaaggagtcgttcgcggt
ctgcactaccaggtcaatccgaacgcggtcggaaagctggtccgttgcgttcacgggcgg
atattcgatgttgccgtggatctgcggctgggatcgccgacctacggcaaatggacgggt
acggagcttgccggcacggacaaccacatgttttacgtcccagagggcttcgcacatggc
ttcatggcgctggaggatgataccctcgtttcctaccggcagacgggatactgggatgcc
gcgtccgagcgatcgctcctatggaacgatcctgacgttgctatagactggcccaaactt
gccgtgctgctttcgccaaaggatgccaacgccacgcgctttgctgacgtcgatcacaat
ttccgctactag

DBGET integrated database retrieval system