KEGG   Agrobacterium radiobacter K84: Arad_4877Help
Entry
Arad_4877         CDS       T00850                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ara01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ara00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3942405..3943574
Genome map
AA seq 389 aa AA seqDB search
MTARKSLDRYRRIVIKIGSALLVDRKTGLKKAWLDGMCADIAALKAKGVDVLVVSSGAIA
LGRSVLDLPSGALKLEESQAAAAVGQISLARAWSESLSHDDIVAGQILLTLGDTEERRRY
LNARATINQLLKIGAVPIINENDTVATSEIRYGDNDRLAARVATMTGADLLILLSDIDGL
YTAPPHLDPDAKFLETIADITPEIEAMAGGAASELSRGGMRTKIDAGKIATGAGCAMIIA
SGKTDRPLNAIANGARSSWFAPSGTPVTARKTWIAGQLQPAGELHVDEGAVTALGAGKSL
LPAGVRKVTGHFGRGDTIAVIGPSGREIARGLVGYDAEEARQITGRKSAEIEAILGYAGR
AAMVHRDDLVMTASVKTKAEKLKKDEAHA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccgcaagtcgctcgatcgctaccgccgcatcgtcatcaagatcggctcggcg
cttctcgtcgaccgcaagaccggcttgaagaaggcctggctcgacggcatgtgcgccgat
atcgccgcgctgaaagccaaaggtgtggacgtcctcgttgtttcctccggcgctatcgcg
ctcgggcgctcggtgcttgaccttccttccggtgccttgaagttggaggaaagccaggcg
gcagccgccgtcggccagatttcgttggcgcgtgcctggtcggaaagcctgtcgcatgac
gatatcgtcgccggccagatcctgctgacgctcggcgataccgaggagcgccgccgctat
ctcaacgcgcgcgccaccatcaaccagcttttgaagatcggcgccgtgccgatcatcaac
gagaacgacacggtcgccaccagcgaaatccgctatggcgacaatgatcgcctggccgcc
cgcgtcgccaccatgaccggcgccgacctgctgatcctgctgtctgatatcgatgggctc
tataccgccccgccgcatctcgatccagacgccaagttccttgaaacgatcgccgacatc
acgcccgaaatcgaggcgatggccggcggtgcggcctcggaactgtcgcgcggcggcatg
cgtaccaagatcgatgccggcaagatcgccacgggtgccggttgcgccatgatcatcgcg
tcgggcaagaccgatcgtcccttgaacgccatcgcaaacggcgcgcgttcctcctggttc
gcaccatcgggcacgcccgtcaccgcccgcaagacctggattgccggacagttacagcca
gccggcgaactgcatgtcgacgagggtgccgtcacagcactcggcgccggcaagagcctg
ctgcccgccggcgtgcgcaaggtcaccggtcatttcggccgtggcgacaccattgctgtc
atcggtccctcgggccgggaaatcgcccgtggccttgtcggttacgatgccgaggaagcc
cgccagatcaccggccgcaagtcggctgagatcgaggcgatcctcggctatgccggccgc
gccgccatggtgcaccgcgacgacctcgtcatgaccgcgtccgtcaagacgaaggccgaa
aaactgaagaaggatgaagctcatgcttga

DBGET integrated database retrieval system