KEGG   Agrobacterium radiobacter: Arad_7256Help
Entry
Arad_7256         CDS       T00850                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ara  Agrobacterium radiobacter
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Arad_7256
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Arad_7256
   00650 Butanoate metabolism
    Arad_7256
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Arad_7256
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Arad_7256
   00622 Xylene degradation
    Arad_7256
   00621 Dioxin degradation
    Arad_7256
Enzymes [BR:ara01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Arad_7256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(237345..238286)
Genome map
AA seq 313 aa AA seqDB search
MERTMTPIKAAIIGSGNIGTDLMIKILRTGSGIEMGALVGVDPASDGLERARRLGVFTTH
EGLDGLRRSPIYKDIGIVFDATSAKAHERHAEQLRQDGKRAIDLTPAAVGPYIVPVVNLE
ENLNAVNVNMVTCGGQATIPIVAAVARVAPVPYAEIVASIASRSAGPGTRANIDEFTETT
ARAIEVVGGARRGKAIIVLNPAEPPLIMRDTVYCLALTQDQDAVRRSIHDMIDRVRGYVP
GYRLKQEVQFEPLRDARAVGGEEDGPALKVSVFLEVEGAGHYLPSYAGNLDIMTSAALAV
AERFARTLIEENA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggagaggacgatgacacctatcaaggcagcaattatcggttcgggcaacattggcacc
gaccttatgatcaagatcctgcggactggatccggaatcgaaatgggtgcgctggtcggc
gtggatcccgcctcggacgggctggaacgagcgcgtcggctcggcgtgttcaccacacat
gaaggtttggacggtctacggcgcagcccaatctacaaagatatcggcatcgtcttcgat
gctacctccgcgaaggcccacgagcgccatgccgaacagctacggcaggacggcaaaagg
gcgattgatctcaccccggcggcagtcggtccgtacatcgtgccggtcgttaacctcgag
gagaacctcaatgcggtgaacgtcaacatggtgacatgcggtggacaggcaacgatccca
atcgttgcggcagtcgctcgggtcgctccggtaccctatgccgagattgtcgcctcgatt
gcctcgcggtcggctggtcccggcacccgcgcaaacattgacgaattcacggagacgacc
gcccgggccatcgaggtcgtcggaggcgcgcggcgcggcaaggccatcatcgttctcaat
ccggccgagccgccccttatcatgcgcgatacggtctattgcctcgcgctgacgcaggac
caggacgcggtgcgtcgatcgatccatgacatgatcgatcgcgtacggggctatgttccc
ggctaccggctgaagcaggaagtgcaatttgagccgctgcgcgatgcccgcgctgttggc
ggcgaggaggacgggccggctctcaaggtctccgtgttcctggaggtcgagggagcgggc
cattatctgcccagctatgccggcaatctcgacatcatgacctcggccgctcttgcggtg
gccgagcgcttcgcccgtacccttatcgaggagaatgcctga

DBGET integrated database retrieval system