KEGG   Agrobacterium radiobacter: Arad_7256Help
Entry
Arad_7256         CDS       T00850                                 

Definition
(GenBank) Acetaldehyde dehydrogenase protein
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00360  Phenylalanine metabolism
ara00362  Benzoate degradation
ara00620  Pyruvate metabolism
ara00621  Dioxin degradation
ara00622  Xylene degradation
ara00650  Butanoate metabolism
ara01100  Metabolic pathways
ara01120  Microbial metabolism in diverse environments
ara01220  Degradation of aromatic compounds
Module
ara_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Arad_7256
   00650 Butanoate metabolism
    Arad_7256
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Arad_7256
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Arad_7256
   00622 Xylene degradation
    Arad_7256
   00621 Dioxin degradation
    Arad_7256
Enzymes [BR:ara01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Arad_7256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACM28798
UniProt: B9JML7
Position
2:complement(237345..238286)
Genome map
AA seq 313 aa AA seqDB search
MERTMTPIKAAIIGSGNIGTDLMIKILRTGSGIEMGALVGVDPASDGLERARRLGVFTTH
EGLDGLRRSPIYKDIGIVFDATSAKAHERHAEQLRQDGKRAIDLTPAAVGPYIVPVVNLE
ENLNAVNVNMVTCGGQATIPIVAAVARVAPVPYAEIVASIASRSAGPGTRANIDEFTETT
ARAIEVVGGARRGKAIIVLNPAEPPLIMRDTVYCLALTQDQDAVRRSIHDMIDRVRGYVP
GYRLKQEVQFEPLRDARAVGGEEDGPALKVSVFLEVEGAGHYLPSYAGNLDIMTSAALAV
AERFARTLIEENA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggagaggacgatgacacctatcaaggcagcaattatcggttcgggcaacattggcacc
gaccttatgatcaagatcctgcggactggatccggaatcgaaatgggtgcgctggtcggc
gtggatcccgcctcggacgggctggaacgagcgcgtcggctcggcgtgttcaccacacat
gaaggtttggacggtctacggcgcagcccaatctacaaagatatcggcatcgtcttcgat
gctacctccgcgaaggcccacgagcgccatgccgaacagctacggcaggacggcaaaagg
gcgattgatctcaccccggcggcagtcggtccgtacatcgtgccggtcgttaacctcgag
gagaacctcaatgcggtgaacgtcaacatggtgacatgcggtggacaggcaacgatccca
atcgttgcggcagtcgctcgggtcgctccggtaccctatgccgagattgtcgcctcgatt
gcctcgcggtcggctggtcccggcacccgcgcaaacattgacgaattcacggagacgacc
gcccgggccatcgaggtcgtcggaggcgcgcggcgcggcaaggccatcatcgttctcaat
ccggccgagccgccccttatcatgcgcgatacggtctattgcctcgcgctgacgcaggac
caggacgcggtgcgtcgatcgatccatgacatgatcgatcgcgtacggggctatgttccc
ggctaccggctgaagcaggaagtgcaatttgagccgctgcgcgatgcccgcgctgttggc
ggcgaggaggacgggccggctctcaaggtctccgtgttcctggaggtcgagggagcgggc
cattatctgcccagctatgccggcaatctcgacatcatgacctcggccgctcttgcggtg
gccgagcgcttcgcccgtacccttatcgaggagaatgcctga

DBGET integrated database retrieval system