KEGG   Agrobacterium radiobacter: Arad_7454Help
Entry
Arad_7454         CDS       T00850                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
ara  Agrobacterium radiobacter
Brite
Enzymes [BR:ara01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     Arad_7454 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(396664..397449)
Genome map
AA seq 261 aa AA seqDB search
MTASPRYWIGTSWKMNKTLAEARGFAEALRDADALRDPAIQRFIIPPFTAVREVKSILSD
TSVKVGAQNMHWADQGAWTGEVSPLMLRDCNLDIVELGHSERREHFGETNETVGLKTEAA
VRHGLIPLICIGETLSDRESGRAAEILSEQVVGALSKLSGSQKQAQILLAYEPVWAIGEK
GIPAEPSYADARQAEIIAVAEKVLGRRIPCLYGGSVNPDNCEELISCPHIDGLFIGRSAW
NVEGYLDILAKCAAKLRGDTK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacagcatcaccgcgctactggattggcaccagctggaaaatgaacaagacgctggcg
gaagcccgcggcttcgccgaggcgttgcgggacgcggatgccctgcgcgaccccgcgatc
cagcgcttcatcatcccgccattcaccgctgtccgcgaggtcaagtcgattctgtcggac
acctcggtcaaagttggcgcgcaaaacatgcattgggccgatcagggtgcatggacaggc
gaagtctctcctctgatgctgagggattgcaatctcgatatcgtcgagcttggccactcc
gagcgccgcgaacatttcggcgagaccaatgagaccgtcggcctgaagaccgaggcggcc
gtccgccatggcctgatcccactcatctgcattggcgagacgttgagcgaccgggaaagc
ggccgcgctgcggaaatcctgagcgaacaggttgtcggcgcgctctccaaactctccggc
tcccagaaacaagctcaaatactgctcgcctacgaacctgtttgggccatcggcgagaag
ggcattcccgccgagccctcctatgccgatgctcgccaggccgagatcattgccgtcgcc
gagaaggtgcttggccgccggattccgtgcctctacggcggatcggtcaatcccgacaat
tgcgaagaactcatctcatgcccgcatatcgacgggcttttcatcggccgttcggcctgg
aatgtcgaaggttacctcgacattctcgccaaatgcgccgccaaacttagaggagacacg
aaatga

DBGET integrated database retrieval system