KEGG   Agrobacterium radiobacter: Arad_7565Help
Entry
Arad_7565         CDS       T00850                                 

Gene name
adhA2
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ara  Agrobacterium radiobacter
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Arad_7565 (adhA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arad_7565 (adhA2)
  Lipid metabolism
   00071 Fatty acid degradation
    Arad_7565 (adhA2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Arad_7565 (adhA2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Arad_7565 (adhA2)
   00626 Naphthalene degradation
    Arad_7565 (adhA2)
Enzymes [BR:ara01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Arad_7565 (adhA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(487943..489025)
Genome map
AA seq 360 aa AA seqDB search
MITKTMMAAVVHRFGEPLVIESVPVPVPGPGELLVKVIACGVCHTDLHAADGDWPVKPSP
PFIPGHEVAGIVAALGQGVTDFKLGDPVGVAWLHDACMRCEYCETGWETLCEHQHDTGYS
CDGGFAEYVIASAAFTARLPANVDFAQIAPILCAGVTTYKGLKETEARPGEWVAISGIGG
LGHVAIQYAKAMGLKIVALDVTPEKLTLARATGADVVIDARSPDAIADVLKATGGGAHGI
LVTAVSPPAFSQALQMVRRKGTIALVGLPPGEFPTPIFDVVLKRITLRGSIVGTRRDLDE
AIAFAVEGKVKADITKVPLNDINAIFAKLKAGKVEGRMVLDFTIPITTSKQKEERAPVEV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgattacaaagacgatgatggcggcggtcgtgcaccgttttggtgagccgcttgtgatt
gaaagcgtgcccgtaccggttcctgggcccggtgagcttctcgtcaaggtcattgcctgc
ggtgtctgccatacggacctccacgccgctgatggcgactggcccgtgaaaccatcgccg
ccattcattcctggccatgaagttgccggtatcgtcgcagcgcttggccagggcgtgaca
gatttcaaactgggcgatccggtcggcgtcgcttggctgcatgacgcctgcatgcggtgc
gaatattgcgaaacaggctgggagaccttgtgcgagcaccagcatgataccggctacagc
tgtgatggcggctttgccgaatatgtcatcgcctcggcagcgttcaccgcgcggcttccg
gctaacgttgattttgcgcagatcgcaccgatcctgtgcgctggcgtcaccacctataaa
ggattgaaggagaccgaggcccgtccgggagaatgggtggcaatttccggcatcggtggc
ctcggccatgtcgcaatccaatatgccaaggcgatgggccttaagatcgtggcactcgat
gtcacaccagagaaactcactttggcacgcgcaaccggtgccgatgtcgtgatagatgcc
cggtcaccggacgcaattgccgatgtcctgaaggcgacgggcggcggtgcccacggcatt
ctggtaacagccgtctcgccacccgccttctcccaggcactccagatggtgcgccgcaaa
ggcacaatcgccctcgtcggcctgccgccgggggaattcccgacgccgatcttcgacgtt
gtgctcaagcgtatcactttacgaggttcgatcgtcgggacacgccgtgacctcgacgag
gccattgcctttgcagtcgagggcaaggtgaaggcggatatcaccaaggtgcccttgaac
gacatcaacgcgatctttgccaagctcaaggccggcaaggttgagggacggatggtcttg
gatttcaccataccgatcaccacgtccaaacagaaagaagaaagggcgccggtcgaggtt
tga

DBGET integrated database retrieval system