KEGG   Agrobacterium radiobacter: Arad_7568Help
Entry
Arad_7568         CDS       T00850                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
ara  Agrobacterium radiobacter
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Arad_7568
Enzymes [BR:ara01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Arad_7568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(490969..493383)
Genome map
AA seq 804 aa AA seqDB search
MEKQPAATFTHPLDDAELDLINRYWRAANYLSVGQIYLLDNPLLREPLKAEHIKPRLLGH
WGTTPGLNFIYAHINRIIRNRDLDIIYICGPGHGGPGMVANTYLEGTYSEIYPDISTDTS
GMHKLFRQFSFPGGIPSHAAPETPGSIHEGGELGYALVHAYGAVFDNPDLIAACVIGDGE
AETGPLAASWHSNKFLNPARDGAVLPILHLNGYKIANPTILGRDTEEDLRHLFIGYGYEP
FFVEGSDPHQMHQAMAATFEQVFDRIRAIQAEARTGMPGNFCPRWPMIVFRSPKGWTGPK
EVDGKKVEGFWRAHQVPVSNCRKDANHRQILEDWMRSYDPQDLFDTDGRLKEELRALAPT
AKRRMGANPHANGGLLRRELIVPNIRAYAVAVKERGRTMAQSTEVLGHYLRDILTLNSDH
TNFRIFGPDETESNRLGSVFEVTDRVWMEEIKPYDVSLAPDGRVMEVLSEHLCQGWLEGY
LLTGRHGLFSCYEAFIHIIDSMFNQHAKWLKVSRELPWRKPISSLNYLLTSHVWRQDHNG
FSHQDPGFIDLVANKRADTVRIYLPPDANTLLWTGDHCLKTYDRINVIVAGKQPEPQWLS
MDEAIKHCEAGIGIWEWAGNEQGAVEPDVVMACAGDVPTMEMLAAVDLLRQNIPELSIRV
VNVVDLMALQSKEQHPHGLADAVFDKLFTPDRPVIFAYHGYPYLIHRLTYRRTNHGNIHV
RGFIEEGTTTTPFDMTVLNELDRYHLAIEAIERVPGLREKAMNVIKLFRDKLEEHGRYIR
QYGEDMPEISNWKWPYDSNGYRLS
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcagccagccgccacgtttacacatccgctcgacgacgccgagctcgatctc
atcaaccgctattggcgagctgccaattacctctccgtcggccagatctacctgctcgac
aatccgctgctgcgcgagccgctgaaagccgagcatatcaagccgcgcctgcttggccat
tggggcacgaccccagggctcaacttcatatatgctcatatcaaccggatcatccgcaat
cgcgatctcgatatcatctatatttgcggccccggccatggtggcccgggcatggtcgcc
aacacctatctcgaaggcacctatagcgagatctatccggatatttccacggatacgtcc
ggcatgcacaagctgttccgccagttctcctttcccggcggcattccgagccacgcggcg
cctgaaacacccggatcgatccatgaaggcggcgaactcggctatgctctggtgcatgcc
tacggcgccgtcttcgacaatcctgatctgatcgccgcctgtgtcattggcgacggtgaa
gcggaaaccggcccgcttgccgccagctggcactccaacaagtttctcaatccggcccgc
gatggcgcggtgctgccgatcctgcatctcaatggctacaagatcgccaatcccaccatc
cttggccgcgacaccgaagaggatctgcgtcacctcttcatcggctacggctacgaaccc
ttcttcgtcgaaggatcggacccgcatcagatgcatcaggctatggccgctaccttcgaa
caggtcttcgatcgcatccgcgccatccaggccgaggcccgcaccggcatgccgggcaat
ttctgcccgcgctggccgatgatcgtgttcagaagtccaaagggttggaccggaccgaag
gaagtggacggcaagaaggtcgagggcttctggcgagcgcatcaagtgccggtttccaat
tgccgcaaggatgccaaccaccggcagatcctggaagactggatgcgaagctatgatcca
caggatctcttcgacacggacgggcgcttgaaagaggaactgcgcgcactggcaccgacg
gccaagcgccgcatgggcgccaatccccatgccaatggcggccttttgcgccgagagctt
attgtgcctaatatccgcgcctatgcggtcgccgtcaaagagcgcggcagaacaatggcg
caatcgaccgaagtcctcggccattatttgcgcgatatcctgaccctcaatagcgatcat
accaatttccgcatcttcggccccgatgagacggagtccaaccgcctcggtagcgtcttc
gaagtgaccgaccgcgtgtggatggaggaaataaagccctatgacgtgagccttgcgcct
gacggacgggtgatggaggtgcttagcgagcatctgtgccagggttggctagagggctat
ctgttgaccggccgccacggcctattctcctgctatgaagcattcatccatattattgat
tccatgttcaatcagcacgccaagtggctaaaggtgtcgcgagagctgccgtggcgaaag
ccgatttcctcgctgaactacctgctgacgtcgcatgtctggcggcaggaccataatggc
ttcagccaccaggaccccggcttcatcgatctagtcgccaacaaaagagccgataccgtg
cgcatctacctgccgccggatgccaacacattgctttggaccggcgaccattgcctgaag
acttatgaccgcatcaacgtgatcgttgccggcaaacagccggagccgcaatggctgtcg
atggatgaagccatcaagcattgcgaggccggtattggcatctgggagtgggctggaaac
gaacagggcgcggtcgaacccgatgtcgtcatggcctgcgccggcgatgtccccaccatg
gaaatgctcgccgccgtcgatcttctccgccagaacattccggaactgtcgatccgcgtg
gtcaacgttgtcgacctgatggcgctgcagtcaaaggaacagcacccgcatggtctcgcc
gacgcggtcttcgacaagttgttcacaccggatcgtccggtcatcttcgcctatcacggc
tacccttatctgatccaccgcctgacctaccggcgcaccaaccacggcaatatccatgtc
cgcggcttcatcgaggagggaacgacgacgacgccgttcgacatgaccgttctcaacgag
ctcgaccgctaccatcttgccatcgaggcgatcgagcgtgtgccgggtctgagggagaag
gcgatgaatgtgatcaagcttttccgcgacaagctcgaagaacacggtcgctatatccgc
caatacggcgaggacatgccggaaatcagcaattggaaatggccctatgacagcaatggg
taccgtttgtcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system