KEGG   Agrobacterium radiobacter: Arad_8178Help
Entry
Arad_8178         CDS       T00850                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ara  Agrobacterium radiobacter
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arad_8178 (tpiA)
   01230 Biosynthesis of amino acids
    Arad_8178 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arad_8178 (tpiA)
   00051 Fructose and mannose metabolism
    Arad_8178 (tpiA)
   00562 Inositol phosphate metabolism
    Arad_8178 (tpiA)
Enzymes [BR:ara01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Arad_8178 (tpiA)
Exosome [BR:ara04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Arad_8178 (tpiA)
  Exosomal proteins of bladder cancer cells
   Arad_8178 (tpiA)
  Exosomal proteins of melanoma cells
   Arad_8178 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1029830..1030585)
Genome map
AA seq 251 aa AA seqDB search
MIVMPRKLIAGNWKMNGLVSDLSEITAIAAAAEGAAAEAVVCPPATLIDRAAAISKGNKL
RIGGQDCHPNSSGAHTGDVSAQMLADIGATYVILGHSERRADHGETSAMVAAKASAAYRA
GLNAIICVGETEGERASGATLAVVEEQLQSSLPDDASAANTTIAYEPVWAIGTGRVPTEE
EIAEVHAALRAALSRRFGAEANDIRLLYGGSVKPANARPIFSIPGVDGALVGGASLKASD
FISILSAASGS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtgatgccccgcaaattgatcgctggaaactggaagatgaatggattggtctcg
gatctgtccgagatcacggcaatcgcggcggcagccgagggtgccgccgccgaagctgtc
gtttgcccgcccgctacactgatcgacagggcggcggccatctccaagggaaacaaactg
cgtattggcggacaggattgccaccccaattcctccggcgcgcatacgggtgacgtttcg
gcccagatgctcgccgatatcggcgcaacatatgtgatcctcggtcattccgagcgccgg
gcggaccacggcgagaccagcgcaatggttgctgcaaaggcatcggctgcctatcgcgcc
gggcttaacgccatcatctgcgtgggtgaaaccgagggcgagagagccagcggcgccaca
ttagctgtcgtcgaagaacaacttcagtcctcacttcccgatgacgcaagtgcggcaaac
acgaccattgcctatgaacccgtgtgggcgatcggaacagggcgtgtcccgacggaagag
gagatcgccgaagtccacgccgccttgcgcgcagcgctttccaggagatttggagccgag
gcaaatgacatccgtttgctctatggcggctcggtgaagccggctaatgctcgcccgatc
ttctcaattccgggagtggatggcgcacttgtcggcggcgcgtcgctcaaggcatcagac
ttcatatcaatcctgtccgccgcgtccggatcgtaa

DBGET integrated database retrieval system